KEGG   Psychromonas ingrahamii: Ping_0226Help
Entry
Ping_0226         CDS       T00450                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00620  Pyruvate metabolism
pin00680  Methane metabolism
pin01100  Metabolic pathways
pin01120  Microbial metabolism in diverse environments
pin01200  Carbon metabolism
Module
pin_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ping_0226
  09102 Energy metabolism
   00680 Methane metabolism
    Ping_0226
Enzymes [BR:pin01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Ping_0226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABM02093
UniProt: A1SRH8
LinkDB All DBs
Position
complement(285034..287670)
Genome map
AA seq 878 aa AA seqDB search
MTEEYSNLRSNVSLLGQLLGKSIGGHLGEEFLDKIETIRQLSKSSRAGNQQDGVALIDML
THLSDDELVPVARAFTHFLNLANIAEQFHGISRHCDSGVCAPEPIKDLISKFKNSNLSQQ
EMQQSVNELKMEMVLTAHPTEITRRTLIHKHIAINDCLSYLEISDISDKERDLLLNRLEQ
LITQAWHTNDIRQKRPTPVDEAKWGFATIEKSLWQAVPQFIRDLESELQSGLGLSLPLEA
SPITFTSWMGGDRDGNPFVTAKVTQEVLLSSRWVAVSLYLKDISQLTDELSMDNCDPALR
SVVGDNAAEPYRAILRKLRSELKETLASLSATLQNQRSDEKDIITTSKQLKEPLLLCYHS
LKNMGMNSIANGLILDILRRLNCFGINLLKLDIRQDAERHGNTLSELTRYLGIGDYNAWN
EEDKQAFLLQELNNKRPLFPSQWNPSAEVQEVLDTCKVVAQTDPEALGIYIISMARQASD
VLAVQLILKEVGCPFRIPVAPLFETLDDLNNSAAVMKRLFAIDWYRGYINGIQHVMIGYS
DSAKDAGVIAANWAQYTSQEALVKLSAENDINLVLFHGRGGTIGRGGAPARQALLSQPPG
SLKGGLRVTEQGEMIRFKFGLPKVAVQSLNQYAAAVLEANLLPPPAPKQEWRDVMQQFSD
QSCQEYRHFVREEPDFVPYFRSVTPEVELGKLALGSRPSKRKPSGGIESLRAIPWIFAWS
QNRLMLPAWLGAGTSLKTLLNEGKKPLLQEMYQHWPFFHTRLEMFEMVFLKADEELTKFY
EERLVPKELWPLGQRLRDNLTLTRETVLETIPDHQLMQEQPWIKESISLRNPYVDPLNML
QAELLYRSRENGDEICPVVDQALMVTIAGIAAGLRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagaatattcaaatttacgcagtaacgtcagtttattaggacagctgcttggt
aaaagcattggtggtcatctcggtgaagagtttctggataaaatagaaactatccgtcaa
ctatccaaatcctcccgtgcgggtaatcaacaggatggtgtcgcactgatcgacatgttg
acccatctttccgatgatgaattagtccctgttgcgcgtgcttttacccactttctaaac
ctggcaaatatcgctgagcagtttcatggcatttctcgccactgcgacagtggggtctgt
gcaccggagccaatcaaagatttaataagcaaatttaaaaattccaatttatcgcagcag
gaaatgcagcagagcgttaatgaattaaaaatggagatggtactgaccgctcaccctacc
gaaataacgcggcgcacacttatccataagcatatcgccattaatgactgtctgagttat
ttagaaattagcgatatttctgataaagaacgcgaccttttgttaaatcgtttagagcag
ttaatcacccaagcctggcataccaatgatattcgccaaaagcgtccgactccggtagat
gaagctaaatggggatttgcgaccattgaaaaaagtttatggcaggctgttccgcaattt
attcgcgatctggaaagtgaattacaaagcggtttaggtttatcattaccccttgaagcg
tcccccatcacctttacctcatggatgggcggcgaccgagatggcaacccctttgtaacc
gccaaagtaacccaggaagtattattatccagccgttgggtcgcggttagtttatacctt
aaagatattagccaactcaccgatgagttatcaatggataactgcgatccagctcttcga
tcagtggttggagataatgcggctgaaccttaccgtgctattttacgcaaattgcgctcg
gaattaaaagaaactttagcatctttaagtgccactttgcagaatcagcgcagtgatgaa
aaagatattatcaccaccagcaaacagttaaaagaaccactgcttttatgttatcactcc
cttaagaatatggggatgaactccattgccaatggtttaattttagatattttacgccgc
ctcaactgttttggtatcaacctgttaaaactggatatccgtcaagatgctgaacgccac
ggcaatacattatcggaattaacccgctacttaggcattggtgattacaatgcctggaat
gaagaagacaagcaggcctttttactgcaggaacttaacaataagcgaccactcttcccc
tctcagtggaacccatctgcagaagtacaggaagtattagatacctgtaaagttgttgcg
caaacagatcctgaagctttaggtatctatattatctctatggcacgccaggcatccgat
gtactggctgtacagttaatattaaaagaagtgggctgtccgttccgtattcctgttgcg
ccattattcgaaacgcttgacgatttgaataactcggcagcagtgatgaaacgcttgttt
gctatcgattggtatcgtggttatatcaatggtattcagcatgtcatgataggttactcc
gactcagccaaagatgcgggggtgatagccgccaactgggcacaatatacatcgcaggag
gcattggttaaactcagtgctgaaaatgatatcaatctggttttattccacggacgtggc
ggcacaataggtcgtggtggtgcgccggctcgccaagccttattatcacaaccgccggga
tctttaaaaggtggcttacgggtcactgaacagggtgagatgatccgctttaaatttggt
ttaccaaaagttgcggtgcaaagtttaaaccaatatgccgctgcggtattagaggctaac
ctgctgccgccacctgcgccaaaacaggaatggcgtgatgtaatgcaacagttttcagat
cagtcttgtcaggaataccgccattttgtgcgcgaagagccagattttgtcccctacttc
cgcagcgtaaccccggaagtggaactgggtaaattagcgctaggcagtcgtccttctaag
cgcaaaccaagcggtggtatagaaagcttgcgcgctattccgtggattttcgcctggagt
caaaatcgtttaatgttgccagcatggcttggggcaggtacctcactaaaaacattattg
aatgaaggaaaaaaaccgctgcttcaggagatgtatcaacactggccatttttccacacc
cgtttagaaatgtttgaaatggtatttttaaaagcggatgaggaactcactaaattctac
gaagaacgccttgtgccgaaagaattatggccacttggacaacgtttacgtgataacctc
acactcactcgagagactgttttagaaactattccggatcatcaattgatgcaggaacag
ccttggattaaggagtctatttcactgcgtaacccttatgttgatccgctcaacatgtta
caagcagagctcctttaccgttcacgtgaaaatggtgatgaaatttgtccggtggtcgac
caggcactgatggtcactattgccggtattgccgcaggacttcgtaatacaggttaa

DBGET integrated database retrieval system