KEGG   Psychromonas ingrahamii: Ping_1124Help
Entry
Ping_1124         CDS       T00450                                 

Definition
(GenBank) rod shape-determining protein MreD
  KO
K03571  rod shape-determining protein MreD
Organism
pin  Psychromonas ingrahamii
Brite
KEGG Orthology (KO) [BR:pin00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pin03036]
    Ping_1124
Chromosome and associated proteins [BR:pin03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    Ping_1124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MreD
Motif
Other DBs
NCBI-ProteinID: ABM02961
UniProt: A1STZ6
LinkDB All DBs
Position
1408690..1409091
Genome map
AA seq 133 aa AA seqDB search
MLNAFRPDWMILIIFYWVLALPHRVSIVHAFILGVVFDLLLGSTLGMHALLFSFLAYIVI
TNYQLFRYFTLVQTTLLVGLYSLLSKLALYLMASSLQDIILHQSYFWSVFTSMLVWPWFF
LFLRFIRRRFKVV
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatgcttttcgtcccgattggatgatccttattattttttattgggtactcgca
ttaccgcatcgggttagcatcgtgcatgcgtttattttaggggtagtatttgacctttta
ttaggctctacgttaggcatgcatgccttattattttcatttttagcctacatagtcatt
accaattaccaactttttcgttatttcactctggtacaaacaaccctcttagtcggtttg
tattctttactgtcgaaactggcgttatatttgatggcatcaagcttacaagatattatt
ttacatcaatcttatttctggtcagtctttacctcgatgctggtttggccctggtttttt
ctttttttgcgttttattcgtcgccgttttaaggtcgtataa

DBGET integrated database retrieval system