KEGG   Psychromonas ingrahamii: Ping_1149Help
Entry
Ping_1149         CDS       T00450                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00473  D-Alanine metabolism
pin00550  Peptidoglycan biosynthesis
pin01100  Metabolic pathways
pin01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pin00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Ping_1149
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ping_1149
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Ping_1149
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pin01011]
    Ping_1149
Enzymes [BR:pin01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Ping_1149
Peptidoglycan biosynthesis and degradation proteins [BR:pin01011]
 Precursor biosynthesis
  Amino acid ligase
   Ping_1149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATPgrasp_Ter ATPgrasp_ST ATPgrasp_YheCD TTL GARS_A ATP-grasp Peptidase_S8_N RimK
Motif
Other DBs
NCBI-ProteinID: ABM02986
UniProt: A1SU21
LinkDB All DBs
Position
1438800..1439720
Genome map
AA seq 306 aa AA seqDB search
MSLDFGKVAVLFGGHSAEREVSLRSGKAVLNALLRQGIDAYAIDPKFDDLLQLKQLNFDR
VFIALHGRGGEDGVIQGFLSTLDIPYTGSDVLSSAIAMDKSKTKQIWQSLQLPTAQYRII
IKEAFDPAQAEQILAGLSGIAIVKPVSEGSSLGMAKVSTAKELIKALTEAFKFDQTVLLE
TWITGQEYTVSILNGKALPAIRMHTNNTFYDYQAKYQSTDTQYYCPCGLEQEKLAELNQL
AVDAFAAIGCRGWGRVDFMLDKSGQWYLLEVNTVPGMTETSLVPKAAKEAGYDFDQLTIE
ILKQTL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagtttagattttggtaaagttgccgtcttatttggtggtcacagtgcggagcgtgaa
gtgtcgttacgttctggaaaagcggtgttaaatgcattgttgcggcaagggattgatgcc
tatgctattgatcctaagtttgatgatttattgcagctaaaacaattaaattttgatcgt
gtttttattgctttgcatgggcgaggaggtgaagatggtgttatacagggatttttaagt
acattggatattccctatacaggcagtgatgttttaagttcggctattgcaatggataaa
tcaaagaccaagcaaatttggcaaagtctgcaattaccaaccgcccagtaccgaattatc
attaaagaggcatttgaccccgcacaggctgaacagatactggcaggtttatcgggcata
gcgatagttaagcccgtcagtgaaggttccagtctcggtatggcaaaagtaagcactgca
aaggagcttattaaagcactgactgaggcttttaaatttgatcagacagtattacttgaa
acgtggatcaccgggcaagagtacactgtatcaatcttaaatggaaaagcattgccggct
atccggatgcacactaataatacattttatgattatcaggctaagtatcaatcgacggac
acacaatattattgtccttgtggtcttgaacaagaaaagctcgctgaattaaatcaatta
gcggtagatgcctttgctgccattgggtgtcgcggatggggacgagtggattttatgctg
gataagtcagggcaatggtatttattagaagtcaataccgtgcccggtatgacagaaaca
agcttagtgcctaaagctgcaaaagaagcgggttacgattttgatcagctgaccatcgaa
attttaaagcaaacactgtaa

DBGET integrated database retrieval system