KEGG   Psychromonas ingrahamii: Ping_2383Help
Entry
Ping_2383         CDS       T00450                                 

Definition
(GenBank) dextran glucosidase
  KO
K01182  oligo-1,6-glucosidase [EC:3.2.1.10]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00052  Galactose metabolism
pin00500  Starch and sucrose metabolism
pin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Ping_2383
   00500 Starch and sucrose metabolism
    Ping_2383
Enzymes [BR:pin01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     Ping_2383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase DUF3459 Cyc-maltodext_C
Motif
Other DBs
NCBI-ProteinID: ABM04120
UniProt: A1SXA5
LinkDB All DBs
Position
complement(2899906..2901606)
Genome map
AA seq 566 aa AA seqDB search
MTIVMTMDAKKNETGTVPESDKKWWHNAVVYQIYPHSFMDANHDGIGDLAGIISKLDYLK
QLGINVIWLSPVFKSPMDDNGYDISDYQDIASEFGTLEEMNKLIAEAAKRDIRIIMDLVI
NHSSDEHPWFIESRKSKDNFYRDYYIWREPKADGSAPNDFKSYFGGSAWEFDGTTGQYYF
HQFSKKQPDLNWDNPKVQEEVHKMINWWLDRGIGGFRMDVIDLIGKDVDKQIMTNGPRLH
PLLQEMNKATFGGRDLLTVGEAWSATPETAKLYSDPARDELSMVFQFEHITITFDPEQGK
WKPRPFDLLEFKQVISKWQTELADCGWNSLFWNNHDLPRAVSKYGDPGCYRVQSAKMLAT
ALHFLKGIPYIYQGEEIGMTNVHFDAIEDYQDIETLNLYQERIAAGVSHEDMMQGIHENG
RDNARTPMQWDSSLNSGFSDGNPWLKLNPNYTEINVESALDDPDSIFYHYQKLVQLRKTH
EVMVYGDYQPLFVEHKKVFSYQRQLGNEKVIVINNFTNEPLELTLPKPLQGLKGQCLISN
YAPRKQLSESLALAPYESFALLIKPC
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgtgatgacaatggatgctaaaaaaaatgagactggcacagtacctgaatca
gataaaaaatggtggcataatgccgtcgtttatcagatctaccctcatagttttatggat
gccaatcatgatggcataggcgatttggcggggatcatcagtaaacttgattacctcaag
caattaggcattaatgttatctggttatcgccggtgttcaagtctccgatggatgataac
ggttatgatatttccgactatcaggatatcgcctcagaattcggcacgttagaggaaatg
aataagctgattgctgaagctgcgaaacgtgatatccgtattattatggatctggtgatc
aaccacagcagtgacgagcatccctggtttattgagtcaagaaaatctaaagataacttt
tatcgcgattattacatttggcgtgagccaaaagccgatggctcagcgccgaatgatttc
aaatcttattttggcggcagtgcttgggagtttgatggtactacggggcaatattatttc
caccagttctctaaaaagcagccggatctaaactgggataatcccaaggtgcaggaagag
gtgcataagatgatcaactggtggttagaccgtggcataggtggtttccggatggatgtg
atcgacttgattggcaaggatgtggataagcagattatgaccaacgggccgcgcctgcat
ccactattgcaagagatgaataaagcaacttttggtgggcgcgatttactgaccgtcggt
gaagcgtggagcgcaaccccggagactgccaagctgtattccgatccggcccgcgatgaa
ctctccatggtgtttcagtttgagcatatcaccatcacctttgatcccgagcaaggtaaa
tggaaacctcggccgtttgatctgctggagttcaagcaggtaatcagcaagtggcaaact
gaacttgctgattgtggttggaactcgttgttctggaataaccatgatctgccgcgcgcg
gtttcaaaatatggcgatccggggtgctaccgcgtgcagtccgctaaaatgctggcgact
gcgctgcatttcctcaaaggtataccgtatatctatcagggagaagagataggcatgacc
aatgtgcatttcgatgccattgaggattatcaggatattgaaaccctgaatctttatcag
gagcgtattgcagcgggcgtctcgcatgaggatatgatgcaggggatccatgaaaatggt
cgtgacaatgcccgcacacctatgcagtgggatagcagccttaacagcggttttagtgat
ggtaacccctggcttaagctcaatccaaattataccgaaattaatgtcgagtcggcattg
gatgatcctgattccattttttaccactaccaaaaactggttcagttgcgcaagacccac
gaggtaatggtctatggtgattatcagccattgtttgttgagcataaaaaggtattttcc
taccagcggcagttaggtaatgagaaagttatcgttattaataacttcacgaatgagccg
ctggagctgaccttgccaaaaccactgcagggattgaaagggcaatgcctgattagcaat
tatgcgccgcgtaagcagttaagcgagtcactcgcgcttgcaccctatgagtcttttgca
ctgctcattaagccgtgttaa

DBGET integrated database retrieval system