KEGG   Pediococcus inopinatus: PI20285_00110Help
Entry
PI20285_00110     CDS       T05337                                 

Definition
(GenBank) AP endonuclease
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
pio  Pediococcus inopinatus
Pathway
pio00040  Pentose and glucuronate interconversions
pio00051  Fructose and mannose metabolism
pio01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pio00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PI20285_00110
   00051 Fructose and mannose metabolism
    PI20285_00110
Enzymes [BR:pio01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     PI20285_00110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 DUF659
Motif
Other DBs
NCBI-ProteinID: AVK99176
LinkDB All DBs
Position
23463..24398
Genome map
AA seq 311 aa AA seqDB search
MKLATRINSFLPVNDNDLRKVFKKFKSLGLNYVDLNYPEHVKDYSSAEMKALLEENDLKL
NGVALRFKEDYISGEIGNPDQAIAAKGLQLCKDAADYCRAVGGHVVTVWLAHDGFDYNFQ
IDYTNVWAQLVKAFQTMADYAPDLRFSIEYKPFQPRAYAFIDSMGVTGMMLSEINRKNVG
VTLDYCHMLMKHENPAMAADIFGGRKQLFGIHLNDGYGMNDDGLMIGTASPFKTLEFLYY
LKKHSYAGMIYFDTFPVIEGATEECEQNMEMIKHLDALIDNVGLEEIQKVIDQNDAIAAH
KLLMKFLSNPA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttgcaactagaattaattcatttttaccagttaacgacaacgatttaagaaag
gtttttaagaaatttaagtcacttggcttaaattatgtcgacttaaattatcctgaacat
gtaaaagattattcttcagcagaaatgaaagcgcttcttgaagaaaacgatcttaaatta
aatggcgtggctttacgattcaaggaagattacataagcggagaaattggaaatcctgat
caagctattgcagcaaaaggtctgcaactttgcaaagatgcggcagattactgtagagct
gttggcggtcatgtagttactgtttggttggcacatgatggttttgactataattttcag
attgactatacaaatgtttgggcgcaactagttaaagcatttcagactatggctgattat
gcaccagatttgcgctttagtatcgagtacaaaccgtttcaaccaagagcatatgcgttt
attgacagcatgggtgttacaggaatgatgctaagtgaaatcaatcgaaaaaatgttggt
gttactttagattactgtcacatgttgatgaaacacgaaaatccagcaatggctgctgat
atatttggtggtcgtaaacagctgtttggaattcatctgaatgatggttatggcatgaat
gatgatggtctgatgatcggaacggcaagtccttttaaaacacttgaatttttgtactat
ctgaagaaacattcttatgccggtatgatttactttgatactttcccagttatcgaagga
gctactgaggaatgtgagcaaaatatggaaatgattaaacatcttgatgcgttaattgat
aacgttggccttgaagaaattcagaaagtgatcgatcaaaacgatgcgattgcagcacac
aaattgttgatgaaatttttaagtaaccctgcataa

DBGET integrated database retrieval system