KEGG   Pirellula sp. SH-Sr6A: VN12_01420Help
Entry
VN12_01420        CDS       T04360                                 

Gene name
inlA
Definition
(GenBank) Internalin-A precursor
Organism
pir  Pirellula sp. SH-Sr6A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_4 LRR_8 LRR_9
Motif
Other DBs
NCBI-ProteinID: AMV30745
UniProt: A0A142XV32
LinkDB All DBs
Position
419895..420755
Genome map
AA seq 286 aa AA seqDB search
MTRSLATQAISALAYAVYSLALVVTATQGPISLAQDIFPDKALEAAVRWEVFEKRYNNEP
IKAEDVKNISQVVARGKGIKSLEGLQHCKAVMKLDLANNEISDLAPIAELKQLQSIDLSG
NQIENIGPIAGLKQSQYLQVSKNKIADLSPIKDLTNLNSLYLNDNQIKSLEHVAALKKLW
TLQAAGNPLENAAAIAELRGLKTLNLNGCGLKKVEFLKGVKELSLLMLDKNPIESLDPLV
EICEADTARRFAPFLRLYLDAKVAGDLNAAIDQLKKVGVRINPEKR
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgactcgatcactcgccacgcaagcaatctctgccctcgcgtacgcggtctattccctc
gccctagtcgtgacggcaacccagggcccgatctcgctcgcgcaggacatttttcctgac
aaagccttggaggccgccgttcgctgggaggttttcgaaaagcgctacaacaacgaaccg
atcaaggcggaggatgtgaaaaacatctcccaagtcgtcgcgcgaggcaagggaatcaag
agcttggaaggactgcaacactgcaaagccgtcatgaagctcgatcttgctaataacgag
atttccgacttggctccgatcgctgaactgaaacaattgcaatcgatagacttgtccggg
aatcaaatcgaaaacatcggtccgattgccggcctcaaacagtcccaatacctgcaagtc
tccaaaaacaaaatcgcggacttgagccccatcaaggaccttacgaacctgaactccctc
tacctcaacgacaatcagatcaaatcgttggaacatgtcgctgcactgaagaaattgtgg
acgcttcaagcagccggaaacccacttgaaaacgcggcagcaattgcagaattgcggggc
ttgaagacgcttaacctcaatggttgtggactgaagaaagttgaattcctcaaaggcgtc
aaagaattgagcttgctcatgctggataaaaaccccatcgaatcgctcgacccacttgtc
gagatctgcgaggcggatactgcccgccgtttcgctccctttcttcggctttatctcgat
gcgaaagtggcaggcgatttgaatgcagccatcgatcagctcaagaaagttggagtccgt
atcaatcccgagaagcgataa

DBGET integrated database retrieval system