Pirellula sp. SH-Sr6A: VN12_01770 Help Entry VN12_01770        CDS       T04360                                  Name (GenBank) sec-independent translocase   KO K03116   sec-independent protein translocase protein TatA Organism pir  Pirellula sp. SH-Sr6A Pathway pir03060   Protein export pir03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:pir00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     VN12_01770  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     VN12_01770  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:pir02044]     VN12_01770 Secretion system [BR:pir02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    VN12_01770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  AMV30814 UniProt:  A0A142XVF4 LinkDB All DBs Position complement(497409..497687) Genome browser AA seq 92 aa AA seqDB search MNSIPFAIIGGIGSSEMVMLGIVALMLFGSRLPEVARNLGGTYRNLRRSVDDFKKEFEAA DPVEPRYIPAAMKEDEEGLQTDAPKFTPPPSS NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaattcaattccattcgcgatcatcggtggcattggcagctccgagatggtgatgctg ggaatcgtcgcgttgatgttgtttgggtcgagacttccggaggtggcccgcaacctggga gggacttatcgaaaccttcgtcgcagtgtcgacgattttaagaaagagttcgaagcggct gatcccgtcgaacctcgatatattccggcagccatgaaagaggatgaagagggtcttcag acagacgctcccaagttcactccaccgccttcttcgtaa

DBGET integrated database retrieval system