KEGG   Pirellula sp. SH-Sr6A: VN12_13465Help
Entry
VN12_13465        CDS       T04360                                 

Gene name
hxlA
Definition
(GenBank) 3-hexulose-6-phosphate synthase
  KO
K08093  3-hexulose-6-phosphate synthase [EC:4.1.2.43]
Organism
pir  Pirellula sp. SH-Sr6A
Pathway
pir00030  Pentose phosphate pathway
pir00680  Methane metabolism
pir01100  Metabolic pathways
pir01120  Microbial metabolism in diverse environments
pir01200  Carbon metabolism
pir01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VN12_13465 (hxlA)
  09102 Energy metabolism
   00680 Methane metabolism
    VN12_13465 (hxlA)
Enzymes [BR:pir01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     VN12_13465 (hxlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase TMP-TENI His_biosynth NMO
Motif
Other DBs
NCBI-ProteinID: AMV33128
UniProt: A0A142Y1K7
LinkDB All DBs
Position
3311402..3312100
Genome map
AA seq 232 aa AA seqDB search
MKPIVQISLDLTNIDEALETAEMAMRAGVDWLEAGTPLILAEGLHGIRALRSRFPNVPIV
ADLKTMDGGYLEAEMMAKAGATHVVVMARAHEETVRCVVKAGKDFGVKVMGDNMICPDMV
AGAKWLEDLGCDYVIHHIGYDERRGIAARGHRMPSPLDQLREVVQAVKIPVQAVGGLSLE
QAVACPSYGAPLVVLGAPLTIDADSFKTASGDLESSLRLICEKIHASETRVF
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgatcgtacaaatttcgctggatctcaccaacatcgatgaagccctcgaaacc
gccgagatggcgatgcgggccggagtcgattggctcgaggcaggcaccccgctcatcctg
gcagaagggctgcacggaatccgcgctctgcgcagccgctttccaaacgtccccatcgtc
gccgatctgaagacgatggacggcggataccttgaggccgagatgatggccaaagcaggt
gcgacccatgttgtcgtcatggcgcgggctcacgaagaaactgtgcggtgcgtggtcaaa
gcgggcaaggactttggggtcaaggtgatgggggacaatatgatatgccccgacatggta
gccggcgccaaatggctagaagaccttgggtgcgactatgtgatccaccatatcggatat
gacgaacgacggggaatcgcggctcgcggccatcgtatgcccagcccgctcgatcaattg
cgcgaggtggtccaagcggtaaaaattcccgtccaagcggtcggtggactgtcgctcgag
caagccgtagcatgcccctcctacggcgctccgctggtcgtattaggtgccccactcacg
atcgacgccgattcgttcaaaaccgcttccggggacttggaaagttcgcttcggttgatc
tgcgaaaaaatccatgctagtgagacccgcgtcttctaa

DBGET integrated database retrieval system