KEGG   Prevotella intermedia: PIN17_A0068Help
Entry
PIN17_A0068       CDS       T02058                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pit  Prevotella intermedia
Pathway
pit00473  D-Alanine metabolism
pit01100  Metabolic pathways
pit01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pit00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PIN17_A0068 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    PIN17_A0068 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pit01011]
    PIN17_A0068 (alr)
Enzymes [BR:pit01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     PIN17_A0068 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:pit01011]
 Precursor biosynthesis
  Racemase
   PIN17_A0068 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AFJ09409
LinkDB All DBs
Position
II:63608..66088
Genome map
AA seq 826 aa AA seqDB search
MSYSIEKITQFINAERYGDTAASISFLLTDSRSLCFPEETLFFALKSDRNDGHHYIPELY
RRGVRNFVVESVPDNFSTLYTHANFLKVGNTLAALQQLTTCHRKAFDIPIVGITGSNGKT
MVKEWLSQLLAYDKNVTRSPKSYNSQIGVPLSIWLLNESSQIGLIEAGISKVGEMQALHD
IIQPTVGVLTSLGAAHQENFSSLEKKCNEKLLLFKGTQALVYQLDDEIAAKCISAAHYDG
KLLAWSEHDTTAAFFVDRIEKSDTASTVSYIWQHATHGSFTLPFIDEASVSNCITCAVVA
LHFGILPDVLAQRMATLEPVAMRLEVKEGQHGCTLINDSYNSDINSLDIALDFMNRRPDQ
KRRERTLILSDIYQSGETEQQLYADVAALVKKRGVKKFIGIGTALGRQQQAFEGLETKFF
FDNIADFIGSKVFKSLHDEVILLKGARSFGFDKLTELLVKKVHETVLEVNLNAVVDNLNW
YRSFLKLETKLVCMIKADAYGAGAVEIAKTLEDHRVDYLAVAVADEGATLRRNGITGNIM
IMNPEMSSFKTLFDYELEPEVYSFRLLDALIKAAEKEGITGYPVHIKLDTGMHRLGFNPR
TDLDLLIEKLHHQNALIPRSVFSHFVGSDSNDFDSFSAAQFALFNEGSKKLQAAFSHRIL
RHMDNSAGIEHFPERQLDMCRLGLGLYGINPRDNAVMSNVSTLKTTILQLRNVPAGETVG
YSRRGIIEKDSVIAAIPIGYADGLNRKLGNRNCYCLVNGKRAYYMGNICMDVALIDVTGI
DCEEGDSVEIFGDHLPVTVLSDAMGTIPYEVLTTVSNRVKRVYFQD
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgagctattcaatagaaaaaataacacaattcataaacgcagaacgatatggtgatact
gctgcaagcatcagtttcctactgacagacagccgttcgctctgctttcccgaagaaaca
ctgttcttcgcactgaagtccgaccgcaacgatgggcatcattacattcccgaattgtat
cgtcgaggcgtgcgcaacttcgtggttgagagcgttcccgacaacttttctacactttat
acgcacgcaaacttcctgaaagtgggcaacacgctcgctgccctccagcagctgacaacc
tgtcatcgcaaggcgttcgacattcccatcgtaggtatcacagggtcgaacggcaagacc
atggtgaaggaatggctgtcgcaactgcttgcatacgacaagaatgtaacacgttcgccc
aaaagctacaactcgcagataggcgttccgctgtcgatttggctgctgaacgaaagttcg
caaatcggtttaatcgaggcgggcatcagcaaagtaggcgaaatgcaggcgttacacgat
attattcagcctacggtgggcgtgctgacgagtttaggtgctgcccatcaagagaacttc
tcatcgttggaaaagaagtgtaacgagaagctgttgctgttcaaaggtacgcaagccttg
gtctatcagctcgacgatgagatagcagcgaagtgcatttcagcggctcattacgatgga
aaactgcttgcgtggtcggaacacgacaccactgcagccttctttgtagaccgtatagag
aagagcgacacggcatcgacagtctcttatatatggcaacacgctacacacggcagcttt
accttgcctttcatcgacgaggcgagtgtcagcaactgcatcacctgcgctgtggttgca
ctgcattttggcattctgcccgatgtgctggcgcagcgtatggcaacgcttgagcctgtc
gcaatgcgccttgaagtgaaagaagggcaacacggctgcacgctcatcaacgactcttac
aactccgatataaactcgctcgacatcgcactcgactttatgaaccgccgtcccgaccag
aaacgacgcgagcgcacacttatcttgagcgacatttatcaaagtggcgaaaccgaacag
cagctttatgccgacgtggcagcattggtaaaaaagcgtggagtaaagaagtttatcggc
attggtaccgctcttggacgacagcagcaggcttttgaaggattggaaacaaagttcttc
tttgacaacatagccgatttcatcggcagcaaagtgtttaaatccttgcacgacgaagtt
atattgctgaaaggagcacgctctttcggcttcgataagctcaccgaactgttggtaaag
aaggtgcacgaaaccgtattggaggtgaatttgaatgccgtagtagacaatctgaactgg
tatcgctccttcttaaagctcgaaacaaagctcgtttgcatgataaaagccgatgcctat
ggagctggggcagtagagatagccaagactttagaggaccatcgcgtcgattatcttgct
gttgcggtggctgacgaaggtgctacgctgcgccgaaacggcattacaggcaacattatg
ataatgaacccagagatgagttcgttcaaaacgcttttcgattacgagcttgaaccagag
gtttatagcttccgtctgttggacgcactgattaaagcagcggagaaagaaggcattacg
gggtaccctgtgcatataaaactcgacacgggaatgcaccgtttgggcttcaatcctcgc
accgacctcgaccttctcatagaaaagctgcaccatcagaatgcgttgataccacgttcg
gtgttctctcacttcgttggttcggacagtaacgacttcgattcgttctctgctgctcag
tttgcgctgttcaatgagggcagcaagaagttgcaggcggctttcagtcatcgcatcttg
cgccacatggacaactctgcaggcatcgaacacttccccgaacgtcagttggatatgtgc
cgattaggactcggactctatggtatcaacccgcgcgacaatgctgttatgagcaacgta
tcgacacttaaaaccaccatattgcagcttcggaatgttccagcaggcgaaaccgtgggc
tattctcgccgtggcatcatcgaaaaagacagcgtcatagcagccataccgattggatat
gccgacggattgaaccgcaaactgggcaaccgcaactgctactgcctcgtcaatggcaag
cgagcctactatatgggcaacatctgtatggacgtggcattgatagatgtaacgggaata
gattgtgaagaaggcgacagcgttgaaatatttggcgaccatttgcccgtaacagtgttg
agcgatgcgatgggaaccattccatacgaggtgctgacaacggttagcaaccgtgtaaaa
agagtttattttcaagattaa

DBGET integrated database retrieval system