KEGG   Prevotella intermedia: PIN17_A0139Help
Entry
PIN17_A0139       CDS       T02058                                 

Definition
(GenBank) glycoside hydrolase 97
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
pit  Prevotella intermedia
Pathway
pit00500  Starch and sucrose metabolism
pit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PIN17_A0139
Enzymes [BR:pit01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PIN17_A0139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AFJ09159
LinkDB All DBs
Position
II:157913..160114
Genome map
AA seq 733 aa AA seqDB search
MNRFKVLIVLLCCSVMAMAQRNVESNSNKWETTASPNGKVVVGFGIDNGRPYYTVQYGKK
DVIKKSFLGLELAKSKHASKGMEETNLMDGFEITETQKTSFDETWKPVWGETSEIRNHYN
EMLVHLLQPTNNRKIMVRFRVYDDGVGFRYEFPQQKELNYFVIKEEHTQFAMAGDHKAWW
LPGDYDTQEQETQESKLSEIRNRFREAVNWNNSTVSVFSETGVQTSLQMKSNDGLYINLH
EAACVNYPTMHLNLDDKSMVFESWLTPDATGMKGYMQTPCETPWRTIIVSDDARDMLSSN
LILNLNEPCKIEDTSWIHPTKYIGVWWEMIVGKNSWNYTDEFPSVQLGKTDYSKAKPNGR
HGATTENVKKYIDFAAENGIDQVLVEGWNIGWEDWYGHSKDYVFDFVTPYPDFDIDYLNK
YAHEKGVKLMMHHETSSSTQNYERHLEAAFNLMNKYGYDAVKTGYVGDIIPRGEHHFSQS
MNNHYMHVIKEAAKHRIMVNAHEAVRPTGLCRTYPNMVGNESARGTEYEAFGGSRPDHTV
ILPFTRLQGGPMDYTPGILETQLKTWSDNTSYVRTTLVGQLALYVTMYSPLQMAADLPEN
YKKFNDAFQFIKDVPCDWSQSIYLEAEPADYITVARQDKNSNDWYIGGKCDENGHKSVLK
LDFLDKDYVYDCTIYADAKDADYKNNPKAYKITHKKVKKGDVLKLTMAPGGGFAVSLEAR
WNGEERVERPTKM
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaatagatttaaggtattgattgtattgctgtgttgttccgttatggcaatggcacaa
aggaacgtagaaagcaacagcaacaagtgggaaacgacagcttctccgaatggtaaagta
gttgtagggtttggtattgacaacggcagaccttactatacggtgcagtatggcaagaag
gacgtgattaaaaagtcgttccttggattggagttggcaaagagcaaacacgccagcaag
ggtatggaagaaaccaatttgatggacggtttcgagataacagaaacgcagaaaacgtcg
ttcgacgaaacttggaaacctgtttggggcgaaacctctgagatacgcaaccactataac
gaaatgttggtacacttgctgcaacctacaaataaccgcaagataatggttcgcttccgt
gtttacgacgatggcgtgggcttccgttacgagtttccgcagcaaaaggaactcaattat
ttcgttatcaaagaagaacatacacagtttgccatggcaggcgaccacaaggcgtggtgg
cttcctggcgattacgacacacaagaacaggaaacacaggaaagcaaactgtcggaaata
cgcaatcgcttccgcgaggctgtgaactggaataactctacggtgtctgtattctcggaa
acgggcgtgcaaacatctttgcaaatgaagtcaaacgatggtctttacatcaatcttcac
gaagctgcgtgtgtcaattaccccacaatgcacttgaatttggacgacaaaagcatggtg
tttgaaagctggctgacgcccgatgccacaggtatgaaaggctatatgcaaactccttgc
gaaactccgtggcgcacaataatcgtcagcgacgatgctcgcgatatgctttcgagcaac
ttgatactcaacttgaacgaaccttgcaagattgaagatacaagttggattcacccaacc
aagtatattggcgtgtggtgggagatgattgtgggcaagaacagctggaattacacagac
gaatttccatctgttcagctcggaaaaaccgattacagcaaggctaaaccaaatggcaga
cacggcgcaacaaccgagaatgtgaagaaatacatcgactttgcagctgaaaatggtata
gaccaagtactcgttgaaggttggaacataggttgggaagactggtacggccattcaaag
gattatgttttcgacttcgtaacgccttatccagacttcgacatcgactatctaaacaag
tatgcgcatgaaaaaggcgttaagttaatgatgcatcacgagacttcttcaagcactcag
aactatgaacgccaccttgaagcggctttcaacctaatgaacaagtacggctacgatgct
gtaaagactggttatgtgggcgatattattccacgaggcgagcaccacttctcgcaatca
atgaacaatcactatatgcacgtgattaaagaagcagccaaacaccgcattatggtgaat
gcacacgaggctgttcgtccgacaggactgtgccgtacatatcctaatatggtgggcaac
gaaagtgcacgtggcacagaatacgaggcttttggtggcagtcgtcccgaccacacggtt
attttacctttcacacgcttgcagggagggccgatggactatacccctggcattcttgaa
acgcagctaaagacttggagcgacaacacaagctacgtgcgtaccacgctcgttggtcag
ctcgcactatacgtaacgatgtacagtccgctgcaaatggcagccgatttgcctgaaaac
tataagaaattcaacgatgctttccaattcataaaagatgttccttgcgactggagccaa
agtatctacttggaagcagagcctgctgattacatcacagttgcgcgtcaagacaagaat
tcaaatgattggtacatcggaggaaagtgcgatgagaacggacacaagagtgttttgaag
ctcgatttccttgataaggattacgtttacgactgcactatctatgctgatgctaaggat
gcggactacaagaacaatccgaaggcatacaaaatcacccataagaaagtgaagaaagga
gatgtcttgaagctgacaatggcacctggtggtggctttgccgtatctttagaggcacgt
tggaatggcgaagaacgagttgaacgaccaacaaagatgtaa

DBGET integrated database retrieval system