KEGG   Prevotella intermedia: PIN17_A1799Help
Entry
PIN17_A1799       CDS       T02058                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pit  Prevotella intermedia
Brite
KEGG Orthology (KO) [BR:pit00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PIN17_A1799 (ahpF)
Enzymes [BR:pit01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PIN17_A1799 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 HI0933_like Thi4 DAO FAD_oxidored NAD_binding_8 Lycopene_cycl K_oxygenase AlaDh_PNT_C Thioredoxin_3 NAD_binding_7 FAD_binding_3 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AFJ08630
LinkDB All DBs
Position
II:1868247..1869806
Genome map
AA seq 519 aa AA seqDB search
MLDKNILDQVKGVFASLKSQITFVATSKKDDEKKGELQEFLNDIASTSEKLSVSFTEEEN
AQLSFKLLKDGNKTGITFRGIPNGHEFTSLLLAVLNTDGQGKNFPDEAIQRRIKSLKGEI
ALKTYVSLTCTNCPDVVQALNLMSLINPNIKHEMVDGGIYQQEVSDLNIQGVPAVYCNNE
SLHIGRGDLGILLQELEDMVGSEALENEESIEREYDVIVIGGGPAGASAAIYSARKGLKV
GLVAERIGGQVNDTTGIQNLISVPNTNGTQLAADLKAHLSDYPIELFEHRKIASVSLKEK
IKSIKVKGGEVFKAPAVIIATGANWRRLNVGDEAKYIGHGVHFCQHCDGPFYKGKNVAVI
GGGNSGLEAAIDLAGICNKVTVFEFGDTLRADTVLQEKAKQIENMSIFTNAQTTNVKGDG
TKLTALTVKDRLTEEEKDYEFDGVFVQIGLAANSDAFKEELELTPRNEIKVDEFCRTAIS
GVYAAGDVSNVPYKQIIVAMGEGAKAALSAFDDRLRGII
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttagataagaatatattagaccaagtaaaaggtgtatttgcatcgcttaaatcgcag
ataacctttgttgcaacaagcaaaaaagacgacgaaaaaaaaggcgaattgcaagaattt
ctcaacgatatagcttcaacatcagaaaaattgtcggttagtttcactgaagaagaaaac
gcacaactcagttttaaactactaaaagacggcaacaaaacaggtattacattccgtgga
ataccaaacggacacgaatttacatcgctccttttggctgttctcaacaccgacggacag
ggcaagaacttcccagacgaagcaatacagcgcagaataaaatcgctgaaaggcgaaatc
gcactgaaaacatacgtttcacttacctgtaccaactgtcctgatgttgttcaggcactc
aacctcatgtcgctcatcaatcctaacatcaagcacgaaatggtagatggcggtatctat
cagcaggaagtaagcgacttaaacatacaaggagtacccgctgtgtactgcaacaacgag
tcgttacacatcggacgaggcgaccttggcatacttttgcaagagttggaagatatggtg
ggcagcgaagcacttgagaacgaagagtcaatagagcgcgaatacgatgtcatcgtcata
ggtggtggtcctgctggtgcgtcagcagcaatttattctgcacgcaaaggcttgaaggtg
ggcttggttgcagagcgaattggcggacaagtaaacgacacgacaggcattcagaacctt
atttctgtgcccaatacaaacggaacacagcttgctgccgacttaaaagcgcacctttcc
gactatcccattgagcttttcgaacaccgaaaaattgcaagcgtaagtttgaaagagaag
ataaagagcatcaaggtgaaaggtggcgaagtgttcaaggctcctgccgtaatcatcgca
acaggtgcaaactggcgcagactgaatgtcggcgacgaagctaagtacatcggacacggc
gtccacttctgccaacactgcgacggacctttctataaaggcaagaacgttgccgtaatt
ggtggcggtaactctggtttggaagcagccatcgaccttgcaggcatttgcaataaagtt
acggtattcgagtttggcgatacccttcgtgccgataccgtattgcaggaaaaggctaag
caaatagaaaatatgagcatttttaccaatgcacagacaaccaacgtgaagggcgacggt
acgaaactgacagcactgactgttaaagaccgcctgacagaggaagaaaaagactacgaa
tttgatggcgttttcgtgcaaataggtcttgcagccaacagcgatgctttcaaagaagaa
ttggaactgacaccacgcaacgagattaaagtagacgaattctgccgtactgccatttca
ggtgtctatgcagcaggcgacgtttctaatgttccatacaaacaaatcattgttgctatg
ggcgaaggtgcaaaagcagctttgtcggcattcgatgaccgtttacgtggaataatctaa

DBGET integrated database retrieval system