KEGG   Paenibacillus sp. JDR-2: Pjdr2_3572Help
Entry
Pjdr2_3572        CDS       T00977                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C 3HCDH_N ADH_zinc_N_2 UDPG_MGDP_dh_N Sacchrp_dh_NADP Oxidored_nitro Methyltransf_25 Neocarzinostat DUF4350 NADH_4Fe-4S Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ACT02205
UniProt: C6D3L2
LinkDB All DBs
Position
complement(4065747..4066766)
Genome map
AA seq 339 aa AA seqDB search
MMKGIVCEQVEQFRYADLEEPVFTPGEAIVSIKRVGICGTDLHAYKGNQPFFTYPRILGH
ELSGLIEQIGDNEEGFKAGDQVSIIPYLHCGKCVACRQGKTNCCTSIQVLGVHADGGMRE
KISVPVTHLLNADGLSLEQAAVVEPFSIGAHAVRRSGLAAGDTVLVIGAGPIGLGIMALA
RHAGANVIAMDVNNERLDFCQEWAKVDHIVNALDAPFVRLEALTGGDYPTIVFDATGNTH
SMSAAVRYAAHGGTLVYVGLVKGYISFDDAEFHKRELTIMGSRNATKEDCQHVLEVIRAG
GIDIDGYVTHLVPFDEMADHFESWLDPANKVIKAMIEWP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaggggattgtgtgcgagcaagttgagcaattcaggtatgcggatctcgaagag
ccggtgtttacgcctggcgaagcgattgtatcgattaaacgggtcggcatctgcggaacg
gatctgcatgcctataaaggaaatcaaccgtttttcacttatccgcgtatacttggccac
gagctgtcgggtttaatcgaacaaataggggataacgaggaaggcttcaaagcaggtgat
caagttagtattatcccttatttacactgcgggaaatgcgtggcatgccggcaaggaaag
acaaactgctgtacatccattcaagtgctgggcgtgcatgccgatggaggcatgcgggag
aaaatctcggttccggttacgcatctgctgaatgcggacgggttaagccttgagcaagcg
gccgttgtggaaccgttcagcatcggagcgcatgccgtccggaggtcgggacttgcggcc
ggcgatacggtgcttgtgattggagctggccccatcggtcttggcatcatggctttagcc
aggcatgccggcgcgaatgtcatcgcgatggatgtaaataacgagcggttggacttttgc
caagagtgggccaaggttgatcatatcgttaacgcgcttgatgctccgttcgttcgtttg
gaggctttgacgggcggcgattacccgaccatcgtatttgatgccacgggaaatacccat
tcgatgtcggcagcggttcgttacgccgcgcatggcggaacgcttgtgtacgtgggattg
gtaaaaggctatatttctttcgatgatgccgaattccacaaacgggaacttacgattatg
ggaagccgaaacgcaacgaaggaagactgccagcatgtactggaggttatccgtgccgga
gggattgatattgacggctatgtgactcatcttgtgccgtttgacgaaatggcggatcat
ttcgaatcctggctggatcctgctaacaaagtgatcaaagcgatgatagaatggccttaa

DBGET integrated database retrieval system