KEGG   Paenibacillus sp. JDR-2: Pjdr2_4010Help
Entry
Pjdr2_4010        CDS       T00977                                 

Definition
(GenBank) Ribonucleoside-diphosphate reductase
  KO
K00526  ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00230  Purine metabolism
pjd00240  Pyrimidine metabolism
pjd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pjd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Pjdr2_4010
   00240 Pyrimidine metabolism
    Pjdr2_4010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pjd03400]
    Pjdr2_4010
Enzymes [BR:pjd01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     Pjdr2_4010
DNA repair and recombination proteins [BR:pjd03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    Pjdr2_4010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_sm
Motif
Other DBs
NCBI-ProteinID: ACT02640
UniProt: C6D5U5
LinkDB All DBs
Position
complement(4554576..4555532)
Genome map
AA seq 318 aa AA seqDB search
MKAVNWNRPDDDFTLTFWQQNVMQFWTDEEIPLSDDKMDWMEMSDTERTVYKNVLGGLTL
LDTIQGGVGMPKILEHVDGLQRKAVLAFMSMMEQIHAKSYSSIFTTLASTEEIDAIFQWV
ETNEQLQKKATLVSSWYQGIETKQQLYKAMAASVFLESYLFYSGFFYPLYLAGQGKMTSS
GEIIDLILRDESIHGLYVGVLAQELFNQFTPEEQAQLKEEVFALLNTLYENEVVYTDNLY
SPIGLQEDVKAYVRYNANKALMNLGFEPYFPEEPVNPIVFNGISTHTKQHDFFSKKGNGY
VRTVHIEQLRDEDFVFNM
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtaaactggaaccgtccggatgacgattttacgcttaccttctggcagcag
aacgtgatgcagttctggacagacgaagaaattccactttccgacgataaaatggactgg
atggaaatgagcgacaccgaacgcaccgtatacaaaaacgtgctgggcggactgacgctt
ctcgatacgattcaaggcggcgtgggcatgccgaaaattctcgagcatgtggacggcctg
cagcgcaaagcggtactcgcgtttatgtcgatgatggagcagatccatgcgaaatcgtat
tccagcatcttcacgacgctggcttcgacggaagaaatcgacgcgatcttccaatgggtt
gaaacaaacgagcagctgcaaaagaaagcgactttggtatcttcctggtaccaaggcatt
gaaaccaagcagcagctgtacaaagcgatggccgcttcggtattcctggagagctacctg
ttctacagcggcttcttctacccgctctatctggctggtcaaggaaaaatgacaagcagc
ggcgagattatcgacctgatcctccgcgacgaaagtatccacggcctgtatgtcggcgtt
ctggctcaagagctgtttaaccaatttacgccggaagagcaagctcaactgaaagaagaa
gtgttcgcccttctgaacacattgtacgagaacgaagtagtgtacacggataacctgtac
agcccgattggcctgcaggaggatgtaaaagcttacgttcgttacaacgcgaacaaagca
ctgatgaacctgggctttgaaccatatttcccggaagagccggtcaacccgatcgtcttc
aacggcatcagcacgcataccaagcagcatgacttcttctcgaaaaaaggcaacggttat
gtgcgtaccgttcatatcgagcaactgcgcgacgaggacttcgtcttcaatatgtaa

DBGET integrated database retrieval system