KEGG   Paenibacillus sp. JDR-2: Pjdr2_4472Help
Entry
Pjdr2_4472        CDS       T00977                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00020  Citrate cycle (TCA cycle)
pjd00480  Glutathione metabolism
pjd01100  Metabolic pathways
pjd01110  Biosynthesis of secondary metabolites
pjd01120  Microbial metabolism in diverse environments
pjd01130  Biosynthesis of antibiotics
pjd01200  Carbon metabolism
pjd01210  2-Oxocarboxylic acid metabolism
pjd01230  Biosynthesis of amino acids
Module
pjd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pjd_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pjd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pjdr2_4472
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Pjdr2_4472
Enzymes [BR:pjd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Pjdr2_4472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ACT03093
UniProt: C6D8B3
LinkDB All DBs
Position
complement(5142799..5144094)
Genome map
AA seq 431 aa AA seqDB search
MAQFEKYALPTEGEQITIDNGALQVPNNPIIPFIEGDGTGRDIWRASKRVLDAAVEKAYG
GSKKIAWYEVFAGEKAFNEFGEWLPADTLTAIREYIVAIKGPLTTPIGGGIRSLNVALRQ
ELDLYTCLRPVRYFAGVPSPVKRPELVDMVIFRENTEDIYAGIEYQEGSEQVKKVIAFLQ
NEMGVNKIRFPETSGIGIKPVSKEGSQRLARAAIEYAIKHGKKTVTLVHKGNIMKYTEGA
FKNWGYEVAEQEFANETFTWGQYDRIKEAEGTDAANKAQAEAEAAGKIVVKDAIADIALQ
QVLTRPTDFDVIATLNLNGDYLSDALAAQVGGIGIAPGANINYLTGHAIFEATHGTAPKY
ADKDVVNPGSVILSGVMMLEHLGWQEAADLIYKGMETSINNKTVTYDFARLMDGATEVKC
SAFADEVIKNM
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcacaattcgagaaatacgcccttccaacagaaggcgagcaaattacaattgataac
ggtgctctccaagtacctaacaacccaatcattcctttcatcgaaggcgacggcacaggc
cgcgacatctggcgcgcatcgaaacgcgttcttgacgcagctgttgagaaagcatacggc
ggcagcaaaaaaatcgcttggtacgaagtattcgcaggcgaaaaagcattcaacgaattc
ggcgaatggctgccagctgacacgctgactgcaatccgcgaatacatcgttgcaatcaaa
ggtcctttgacaactccaatcggcggcggtatccgttccctgaacgtagcgcttcgccaa
gagcttgacctgtacacttgccttcgtcctgttcgttacttcgctggcgtaccatccccg
gttaaacgtcctgagctggttgacatggttatcttccgtgagaacactgaagacatctat
gctggtatcgagtaccaagaaggctccgagcaagtgaagaaagttattgcgttcctgcaa
aacgaaatgggcgttaataaaatccgtttccctgaaacttccggtatcggcattaagcca
gtatccaaagaaggctcccaacgtcttgctcgcgctgcaatcgaatacgcgatcaagcat
ggcaagaaaacagttactctggttcacaaaggcaacatcatgaaatatacggaaggcgcg
ttcaagaactggggctacgaagtggctgagcaagagttcgctaacgaaaccttcacttgg
ggtcaatacgaccgcattaaagaagcagaaggcacagacgctgctaacaaagcacaagca
gaagctgaagctgctggcaaaatcgtcgtaaaagacgcgattgccgacatcgctctgcaa
caagttctgactcgtcctactgactttgacgtaatcgctacattgaacctgaacggcgac
tacctgtccgacgctctggctgcacaagttggcggtatcggtatcgctccaggcgctaac
atcaactacctgactggtcatgcgattttcgaagctactcatggtactgctcctaaatac
gcagacaaagacgtagttaacccaggttccgtaattctgtccggcgttatgatgcttgag
catctgggctggcaagaagcggctgaccttatctataaaggtatggaaacttcgatcaac
aacaaaaccgttacttatgacttcgcacgcctgatggatggcgctactgaagtaaaatgc
tcggcatttgctgacgaagtaattaaaaacatgtag

DBGET integrated database retrieval system