KEGG   Paenibacillus sp. JDR-2: Pjdr2_4984Help
Entry
Pjdr2_4984        CDS       T00977                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pjd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Pjdr2_4984
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pjd03400]
    Pjdr2_4984
Enzymes [BR:pjd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Pjdr2_4984
DNA repair and recombination proteins [BR:pjd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Pjdr2_4984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M RNA_ligase DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ACT03595
UniProt: C6D0J6
LinkDB All DBs
Position
5699129..5700079
Genome map
AA seq 316 aa AA seqDB search
MTVFTLPAEPMIPVADDHVPKESGWIYQIKWDGVRIVATVHDEGRIDLFSRKLLNKNAVY
PEIHRTLQEQAEALGPCMLDGEIVYYDGERPNFQMVLSRERSFGGDLSSSSSKGKVLYVL
FDLLQDGEEDLRPLPYAERHKRLLAKLKPVQSDRLLIADLYTDADALWKWVDDHQWEGIV
SKRLDSSYKEGKAHRDWLKKKRALLLDVGIVGVKRRDGRAASLVMSDQGRFIGSVSLGLD
EAMREALGQMLQLRRSDAPSWPMPFPALPAELKGESIIWLPSPLPCRVTGLELTSAGLLR
HPKLVSFGLKPSGGHS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgacggtctttacgctgcctgccgagccgatgattcctgtcgcggatgaccatgtcccg
aaggagtccggctggatctaccagatcaaatgggacggcgtccgaatcgtcgctacggtt
catgatgaaggcaggattgacttgttctcgcgcaagctgctgaataaaaatgccgtctac
ccggaaatccaccggacattgcaggagcaggctgaagctcttggtccctgcatgctggac
ggagagatcgtctattacgatggcgaacgtccgaattttcaaatggtactaagccgtgaa
cgcagctttggcggggatctctcttcgtcttcaagcaaagggaaagtgctgtatgttctc
ttcgacctgctgcaggacggcgaggaggatttgcgcccgcttccctatgcggagcggcat
aaacggctgcttgccaagctgaagcccgtccaatccgaccggctacttatagctgatcta
tatacggatgcggatgctctatggaaatgggtcgatgaccatcagtgggaaggaatcgtc
agcaagaggcttgatagttcctataaggaaggcaaagctcatcgcgattggctgaaaaag
aaacgggctctcctgcttgacgttggcatcgtaggcgtaaagcgccgcgacggccgcgca
gctagtctagtcatgtccgatcaggggcgttttatcggaagcgtctcgcttggccttgac
gaagccatgcgggaagcgcttggccaaatgctgcagctgcggagaagcgatgctccttcg
tggccgatgccttttccggctttgccggctgagcttaaaggcgagagcattatttggctg
ccgtccccgcttccttgccgggtaaccggactcgagctgacatccgccggattattaagg
catcccaagcttgtatcctttggtctaaaaccatcaggaggccactcatga

DBGET integrated database retrieval system