KEGG   Paenibacillus sp. JDR-2: Pjdr2_5336Help
Entry
Pjdr2_5336        CDS       T00977                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00564  Glycerophospholipid metabolism
pjd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pjd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Pjdr2_5336
Enzymes [BR:pjd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Pjdr2_5336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ACT03946
UniProt: C6D2L8
LinkDB All DBs
Position
complement(6131340..6133028)
Genome map
AA seq 562 aa AA seqDB search
MASGNGHGGGPALFNALKREEQFGRLQAEEYDLLIIGGGITGAGIALDAVTRGLKTALVE
MQDFAAGTSSRSTKLVHGGLRYLKQLEIGVVAEVGKERAIVYENGPHVTTPEWMLLPIYK
GGSFGKFSTSLGLRLYDFLAGVKRAERRKMLGTDETVTREPLLKRKGLKGGGYYVEYRTD
DARLTIEVMKKAFDLGACALSYVKAESLLYENGRIAGAELRDQLTGNMGQVKAKVTINAA
GPWVDTIREKDGSKKGKTLHHTKGVHLVFDQKRFPLGQAIYFDSADGRMLFAIPRDGKTY
IGTTDTDYKEDLVHPRMTAADRQYILKAANGMFPTLGLKAEDVESSWAGVRPLIHQEGKD
PSEISRRDEVLVSPSGLLSMAGGKLTGYRKMAETVMDQAAEQLAKAGRVNIGSSQTKTLP
ISGGDVGGAGGYERFIADKAAAAVTAGLAGSDAERLVRRFGSNIDTVISLMSEAQEEAIR
RKLPVTLLLELLYAIRHEMACKPVDFWIRRSGSLLFDRSRVIRWKDGVHRYMAELFGWSA
GISAAYAGELERELQLAVAPTE
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcgggaacgggcatgggggaggaccagctttatttaacgctctaaagagagag
gagcagttcgggcggctgcaggcggaggaatacgatctgcttattatcggcggaggcatt
accggggcggggatcgcgcttgacgcggttacgcggggattaaagacggcgctggtggag
atgcaggattttgccgcgggtacgtcaagccgttcgaccaagctggtgcatggcggtctg
cgttacttgaagcagctcgagatcggagttgtagccgaggtcggcaaggaacgcgccatt
gtgtacgagaacgggccgcatgtgacaacgccggaatggatgctgctcccgatctataaa
ggcggcagcttcgggaagtttagtacttcgcttgggcttcgtttgtatgattttctggct
ggagtcaaacgcgccgagcggcgaaaaatgcttggaacggacgagacggtcacgcgcgag
ccgcttctgaagcggaaaggcctgaagggcggcggctattatgtcgaatatcgtaccgat
gatgccagattaacgattgaagtgatgaaaaaagccttcgatctgggagcatgcgcgctc
tcttacgtgaaggccgaatcgctgttgtacgagaacgggcggatcgccggtgcggagctg
agggatcaactgacgggcaacatgggacaagtgaaggcgaaggttactattaatgctgcc
ggtccttgggtagatacgatacgggagaaggacggatccaagaaagggaagacgctccat
catacgaaaggcgtccatctcgtattcgaccagaaaaggttcccgcttggtcaggcgatc
tacttcgactcggcggacggccggatgctgtttgcgattccccgcgacggaaagacgtat
atcggcacaaccgataccgattacaaggaggaccttgtccatcctcggatgacggctgca
gaccgccagtatattttgaaagcggctaacggtatgttccctacgcttgggctgaaagcc
gaggatgtggagtccagctgggcaggcgtacggccgcttattcaccaggaagggaaagac
ccttccgagatttcgcggcgcgacgaggtactggtatcgccttcgggccttctctccatg
gcaggcggcaagctgaccggctaccggaaaatggccgagaccgttatggatcaggcggca
gagcagctcgccaaagccgggcgcgtcaatattggctcaagccaaacgaagacgcttccg
atctcgggaggcgacgttggcggcgcgggagggtatgagcgatttatcgcggataaagcg
gcggctgccgtcacggcggggctcgccggctccgatgcggaacggcttgtccgacggttc
ggttccaacatcgataccgtgatcagccttatgtccgaagcgcaggaagaagcgatccgc
cgaaagcttccggttacgcttctgctggagctgttgtatgcgatccgccacgagatggcc
tgcaagccggtcgacttctggatccgccggagcggcagcctcctgttcgaccgcagccgt
gtcatccgctggaaggacggcgtgcaccgttatatggcggagctattcggctggtccgcc
ggcataagcgctgcttatgccggggagctggagcgcgagctccagctggcggtggcaccg
acggagtag

DBGET integrated database retrieval system