KEGG   Paenibacillus sp. JDR-2: Pjdr2_5375Help
Entry
Pjdr2_5375        CDS       T00977                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00473  D-Alanine metabolism
pjd00550  Peptidoglycan biosynthesis
pjd01100  Metabolic pathways
pjd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pjd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Pjdr2_5375
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Pjdr2_5375
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Pjdr2_5375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pjd01011]
    Pjdr2_5375
Enzymes [BR:pjd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Pjdr2_5375
Peptidoglycan biosynthesis and degradation proteins [BR:pjd01011]
 Precursor biosynthesis
  Amino acid ligase
   Pjdr2_5375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 RimK GARS_A ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ACT03985
UniProt: C6D2Q7
LinkDB All DBs
Position
complement(6172000..6172911)
Genome map
AA seq 303 aa AA seqDB search
MMKIGVIMGGISSEREISLLTGQEMIANLDRGKYEVVPIEINTKRDLIDKTAGIDFALLA
LHGKYGEDGTVQGTLESLGIPYSGCGVLSSSVSMDKELAKKLIRFDGILTADWINVASME
ELAAANVERLGLPVVVKPNSGGSSIATRLVKTQDEVAEAVAEALKWDDSVMIEQFVGGEE
ITCAVLSGKLLPIVSIKANSEFFDFDSKYQDGGATEEVIELPADVQARVEASALGCYKAL
KCSVYSRIDMIIKDGVPYVLEANTLPGLTKNSLLPKAAKAAGIKFNELLDYIIDYSLEER
KEK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaatcggtgttattatgggcggcatttcgtccgaaagagaaatttcgttatta
acggggcaagaaatgatcgcgaatctggatcgcggcaaatacgaagttgtgccgatcgag
attaacacgaaacgcgacttaatcgataaaacggccggtatcgactttgcgctgctggct
cttcacggcaaatacggcgaagacggtacggtacagggcacgttggaatcgcttggcatt
ccttattccggctgcggcgtgttgtcgagcagcgtaagcatggataaagagctggcgaaa
aagctgatccgttttgacggcatccttacagccgattggattaatgtcgccagcatggag
gagcttgccgcggcaaacgtggagcgccttggcctgccggttgtcgtaaagccgaattcg
ggcggctcgagtattgctacgcgtctggttaaaacccaagacgaggtggccgaagcggta
gcggaagcgttgaaatgggatgactccgtcatgatcgagcaatttgttggcggggaagaa
attacatgcgccgtgctcagcggcaagctgcttcctatcgtatcgattaaagccaactcg
gagttcttcgatttcgactccaagtatcaggatggcggagccacggaagaagtgatcgaa
ttgccggctgatgtgcaagcccgcgtagaagcgtctgcgcttggctgctataaggctctg
aaatgcagcgtgtattcgcgtatcgatatgatcattaaagacggagttccgtacgttctg
gaagcgaacacgctgccgggtctgacgaagaacagcttgctgccaaaggcggctaaagcg
gctggtatcaaattcaacgagctgcttgactacatcatcgattattctcttgaggaacgt
aaagagaaataa

DBGET integrated database retrieval system