KEGG   Paenibacillus sp. JDR-2: Pjdr2_5399Help
Entry
Pjdr2_5399        CDS       T00977                                 

Definition
(GenBank) glycine oxidase ThiO
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00730  Thiamine metabolism
pjd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pjd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Pjdr2_5399
Enzymes [BR:pjd01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     Pjdr2_5399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 NAD_binding_8 FAD_binding_2 HI0933_like Pyr_redox_3 Pyr_redox FAD_oxidored Thi4 UDPG_MGDP_dh_N Amino_oxidase ApbA GIDA FAD_binding_3 AlaDh_PNT_C AdoHcyase_NAD TrkA_N
Motif
Other DBs
NCBI-ProteinID: ACT04009
UniProt: C6D362
LinkDB All DBs
Position
complement(6193407..6194513)
Genome map
AA seq 368 aa AA seqDB search
MGETIVIMGGGVVGLSCAFELQKRGHQVIVLEIGRCGGQASGAAAGMLAPYSENVEGPDD
FFRLCRESLRLYPSWRDEVRQISGRTFEYTDSGSLYIAYHEADRLALEGRRLWQNEHGSS
GIVLEGEELFRQEPMLSHEVKAALYTPEESHVYAPDYVLALEQACRLTGVRIFEQLGSVT
VDKWREDVVVTAQTGWSFTGDRLVVCSGAWARELEDVFGIRIPVYPIRGQICAYEAEVKP
VQHMVFCNQGYLVAKENGTLVCGASEDVAGFDTTVTERGIERLRKWNKQAFPFLAGQEPF
HRWAGLRPSTQDGFPLLGPVQESGGRVIMAAGHYRNGILLSPVTAQVVADYIDNGSRLQA
FAPERFSY
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaacgattgtcattatgggcggaggcgtagttgggctttcctgcgctttcgag
ctgcagaagcgcgggcatcaggttattgtcctggagattggccgctgcggcgggcaggct
tccggcgctgcggccgggatgctcgcaccctactcggaaaatgtagaagggccggatgat
ttcttccgtttgtgccgggaaagcctgcggctgtatccgtcctggcgcgacgaggtccgg
cagatatccggccgtacgttcgaatataccgattcgggcagcctctatattgcctatcac
gaggcggaccgtctggcgctggaggggcgtcgcctctggcagaacgagcacggatcaagc
ggcattgtgctggaaggggaagaactgttccgccaagagccgatgttgtcccacgaggtg
aaggccgctctctacacgccggaggaaagccatgtctatgcgccggattacgtgttggcg
cttgagcaggcatgccgcctgaccggtgttcgaatcttcgagcagttaggttcggtaacc
gttgataagtggcgcgaggatgtcgttgttaccgcccagacggggtggagctttaccggc
gaccggctggtcgtctgctccggcgcctgggcacgggagcttgaggatgtattcggcatc
cgtattccggtgtacccgatccgcggtcagatttgcgcttatgaagcggaagtaaagccg
gtgcagcatatggtgttctgcaatcagggttatttggttgcaaaagaaaacggcacgctt
gtatgcggggcttccgaggatgtggcgggctttgacacaaccgttacggagcggggaatc
gagcggctgcgcaagtggaacaagcaggcgttcccgtttctcgccgggcaggagccgttt
caccgctgggcaggcctgaggccttccacgcaggatggattcccattgcttggaccggtt
caggaatcgggcggccgcgtcattatggcggcgggccattaccgcaacggtattcttctc
agcccggttacggcacaggttgtggccgattatatcgataacggcagcaggctgcaggcg
tttgcgccggaacggttttcctactaa

DBGET integrated database retrieval system