KEGG   Paenibacillus sp. JDR-2: Pjdr2_5424Help
Entry
Pjdr2_5424        CDS       T00977                                 

Definition
(GenBank) Aldehyde dehydrogenase (NAD(+))
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00010  Glycolysis / Gluconeogenesis
pjd00620  Pyruvate metabolism
pjd01100  Metabolic pathways
pjd01110  Biosynthesis of secondary metabolites
pjd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pjd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pjdr2_5424
   00620 Pyruvate metabolism
    Pjdr2_5424
Enzymes [BR:pjd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Pjdr2_5424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ACT04034
UniProt: C6D387
LinkDB All DBs
Position
complement(6214531..6216051)
Genome map
AA seq 506 aa AA seqDB search
MIYAEPGKQDSKITFKKRYENYIGGRWTPPTQGQYFENVSPVNNAAFCEVARSTSEDIEL
ALDAAHAAKAAWGRTSATERANILNRIADRIESNLETLAVAETWDNGKPIRECLAADLPL
AIDHFRYFAGCIRAQEGSLSQLDNDTVAYHYHEPLGVVGQIIPWNFPLLMATWKLTPALA
AGNCVVLKPAEQTPASICVLMELIEDLLPAGVVNIVNGFGLEAGKPLASSNRIAKIAFTG
ETTTGRLIMQYASQNLIPVTLELGGKSPNIFFEDIMAKDDAFFDKALEGFTLFALNQGEV
CTCPSRALIQESIYDSFMEKALRRVASIKQGNPLDTDTMIGAQVSTEQMEKILSYIDIGR
QEGAECLIGGGRAAIQGDISQGYYIQPTVLRGNNGMRIFQEEIFGPVVAVTTFSTPEEAL
AIANDTLYGLGAGVWTRDINAAFRMGRQIEAGRVWTNCYHAYPAHAAFGGYKMSGVGREN
HKMMLSHYQQTKNLLVSYSPDALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgctgagccgggtaagcaggattcgaagattacgtttaagaaacggtacgag
aactacatagggggccgctggacgccgccaacgcaaggccaatatttcgaaaatgtttct
cccgtgaacaacgcggccttctgcgaagtagcccgttccacatcggaggatatcgagctt
gcgctggacgcggcgcatgcggcaaaggccgcctggggacggacctccgcgacggagcgc
gcgaacattctgaaccggattgccgaccggatcgagagcaatctggagacgctcgccgtt
gccgagacctgggataacggcaagccgatccgcgaatgtctggcagccgatctgccgctg
gcgatcgatcacttccggtatttcgccggctgcatccgcgcgcaggagggctcgctcagc
cagctcgacaacgacacggtcgcttaccattatcatgagccgcttggcgtcgttggccag
atcatcccttggaacttccctttgctgatggcgacgtggaagctcactccggcactggcg
gcaggcaactgcgtagtgttgaagccagcggagcagacgccggcttcaatctgcgtgttg
atggagttgatcgaggatttgctgcctgccggcgttgttaacatcgttaacggctttggg
ctggaagcgggcaagccgcttgcatcaagcaaccggatcgcgaagattgccttcactggc
gagaccacaaccgggcgcctcatcatgcagtacgcctcgcaaaatctcattccggtaacg
cttgagcttggcggcaaatcgccaaacatcttcttcgaggatattatggcgaaggatgat
gcctttttcgacaaggcgctggagggctttacgctgtttgcgctgaatcagggtgaagtg
tgtacttgcccgtcccgcgcgctgattcaggagtcgatctacgacagctttatggagaag
gcgctgcggcgtgtcgcatccatcaagcagggtaatccgctcgacacggatacgatgatc
ggggcgcaggtatccaccgagcaaatggagaaaatcttgagctatatcgacatcggccgc
caggaaggcgccgaatgcctgattggcggaggccgcgcggctatccaaggcgatatttcg
cagggctactatattcagccgaccgtgcttcgcggcaataacggcatgcggattttccaa
gaggagatctttgggccggttgttgccgttaccaccttcagcacgccggaggaagcgctg
gcgattgccaatgatacgttgtacgggcttggagccggcgtatggacgcgggatatcaac
gcggcgttccggatgggccgtcagatcgaggcgggccgcgtctggaccaactgctaccat
gcttacccggcgcatgcggcgtttggcggctacaaaatgtccggcgttggccgcgagaac
cacaagatgatgctgtctcattaccagcagacgaagaacctgctcgtcagctacagcccc
gatgcgttaggcttcttctga

DBGET integrated database retrieval system