KEGG   Paenibacillus sp. JDR-2: Pjdr2_5636Help
Entry
Pjdr2_5636        CDS       T00977                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00620  Pyruvate metabolism
pjd00680  Methane metabolism
pjd01100  Metabolic pathways
pjd01120  Microbial metabolism in diverse environments
pjd01200  Carbon metabolism
Module
pjd_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pjd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pjdr2_5636
  09102 Energy metabolism
   00680 Methane metabolism
    Pjdr2_5636
Enzymes [BR:pjd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Pjdr2_5636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 zf-C3H2C3
Motif
Other DBs
NCBI-ProteinID: ACT04244
UniProt: C6D470
LinkDB All DBs
Position
complement(6466300..6469110)
Genome map
AA seq 936 aa AA seqDB search
MSDQVTSTLSAQHRPQANNLLRRDVRFLGNILGEVLVHQGGRELLDIVEQIRETSKALRA
EFVPELFEQFKTTIASLSPEIRHQVIRAFAIYFQLVNIAEQNHRIRRKRDYERSAGESVQ
RGSIESAISDLKERNIDIEGVQEILSNISLELVMTAHPTEATRRAVLDIHKRIAEDVMEL
DNPTLTYREREILRDKLLNEVLILWQTDELRDRKPTVIDEVRNGLYYFDETLFEVLPNVY
EELERNLTKYYPGESWHVPSYLRFGSWIGGDRDGNPSVTAKVTWETLTLNRQLAIKKYEE
KLHELVSILSFSTNLVEVSEELINSIKKDREHVELKCIDLWRNAKEPYRIKLGFMLEKLA
NTRDESLKGSAMRYNSAGELLEDLYIIDRSLRGHFADYVADTHIGKLVRQVELFGFHMLT
LDIRQHSQEHENAMAEILAKMNIVSNYGSLSEEEKIELLSNLLEDPRPLTSSHLDYSAST
RECLDVYHTVYRAQQEFGPECISTYLISMTQGASDMLEVMVFAKEVGLFRKEADGSVRCT
LQSVPLFETIDDLHAAPGIMKLLFELPIYRQAVAARGDLHEIMLGYSDSNKDGGAVTANW
ELRVALNDITATAGEHGVKLKFFHGRGGALGRGGMPLNRSILAQPPHTVGGGIKITEQGE
VLSSRYSMQGIAYRSLEQATWALVTAARLAKYPQAQDDAVLKEWEEISRSISETALNKYQ
DLIFRDPDFLTYFKESTPLPEVGELNIGSRPSKRKNSDRFEDLRAIPWVFAWTQSRYLLP
AWYAAGTALKQYTGDDAQRLETLKTMYEKFPFFRSLIDNLQMALAKADLTIAKEYADMIA
DSTIRDRIFTQIENEYTLTSDMILSITGQDEILDNVPVIQESIRLRNPYVDPLSYMQVQL
LTELRELRAKEEDDPELLREVLLTINGIAAGLRNTG
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaccaagtaacatcgactttatcggcacaacatcggccgcaggctaacaatttg
ctgcgcagagacgtccgtttcctaggcaacatacttggggaagtgctcgtccatcaaggc
ggccgcgaactgctggatatcgtcgagcaaattcgtgaaacaagtaaagcgttacgcgct
gaatttgtacctgagctttttgaacagtttaagacgacaattgcatcattaagtcccgaa
attcgccatcaggtgatccgtgcattcgcgatctatttccaattggtcaacattgcagag
cagaaccaccgtattcgccgtaaacgcgactacgagcgttccgcaggggaaagtgtacaa
cgaggttccattgagagcgcgatttccgatctgaaagagcgcaacatcgatattgaaggt
gttcaagagatcttgagcaacatttcactcgagctcgtgatgactgcgcatccgacggaa
gcgacgcgtcgtgccgtgcttgatattcataagcggattgccgaagacgtaatggagctt
gataatccgactctgacataccgcgaacgcgaaatccttcgggacaagctgctgaacgaa
gttcttattctgtggcagaccgatgaactgcgcgaccgtaagccaactgttatcgacgaa
gtgcgcaacgggttgtattacttcgacgaaaccctgtttgaggtgcttcctaacgtatac
gaagaactggaacgcaatcttacaaaatattatccgggcgagtcctggcatgtaccaagc
tacctgcgctttggctcatggatcggcggagaccgcgacggcaacccgtccgtaaccgct
aaggtaacatgggagacgctgacgcttaaccgccagctggctattaagaaatacgaagag
aaactgcatgaacttgtcagcattctgagcttcagcacgaaccttgttgaggtatccgaa
gagctgattaactcgattaagaaagaccgcgagcatgttgagctcaaatgcatcgacctg
tggcgtaatgcgaaggaaccttaccgcattaagctgggctttatgctggagaagctggct
aatacgcgcgacgagtcgcttaaaggctctgcaatgcgttataacagcgcaggcgagctg
cttgaggatctttacattatcgaccgcagcttgcgcggacattttgccgattatgtagcg
gatacgcacattggcaagcttgtacgccaagtggagctgtttggcttccatatgcttacg
cttgatatccgtcaacacagccaagagcatgagaatgcgatggctgaaattttggcgaag
atgaatatcgtttcgaactacggctccttgtcggaagaagaaaagattgaattgctcagc
aatttgctggaggaccctcgtccgcttacttcttcccatctcgattactcggcatcgacc
cgcgagtgcctggacgtgtatcacacggtctacagagcacagcaagagtttggtccggaa
tgtatttcgacttatctgataagtatgacacaaggcgccagcgacatgctggaggttatg
gtattcgcgaaagaggttggcctgttccgtaaggaagcagacggcagcgttcgttgcact
ctgcaatccgtgccgcttttcgagacgattgacgacctccacgcagcacccggcatcatg
aagctgctcttcgagcttccaatctatcgtcaagccgtagcggcaagaggcgacctgcat
gaaatcatgctgggttactccgatagcaataaagacggtggcgcggtaaccgcgaactgg
gagctgcgcgtagcgcttaatgatattacggcaactgccggcgaacacggcgttaagctg
aagttcttccatggccgcggcggtgcgcttggccgtggcggtatgccgcttaaccgcagt
atcctggctcaaccgcctcatacggttggcggcggtattaaaattaccgagcaaggtgaa
gtattgtcctcgcgttattcgatgcagggcattgcttaccgcagcttggagcaggcaaca
tgggcgctcgttacggctgcccgtcttgcgaaatacccgcaggcacaagatgatgccgtg
ctgaaagagtgggaagagatttcccgttcgatctcggaaacagcactgaacaaatatcag
gatctgatcttccgcgatccggacttcctgacttacttcaaagagtcgactccgcttccc
gaggttggcgagctgaatatcggttcccgtccatcgaaacggaaaaacagtgaccgcttt
gaagacctccgtgcaattccttgggtatttgcatggacgcagagccgttatctgctgccg
gcatggtatgcggcaggtactgccttgaagcaatataccggcgatgatgcacaacgtctt
gaaacattaaagacgatgtacgagaaattcccgttcttccgttcgcttatcgacaatctg
caaatggcacttgctaaagcagatttgacgattgcgaaggagtatgcggatatgatcgcc
gacagcacgattcgtgaccgtatcttcacgcagatcgagaacgaatatacactgacttcg
gatatgatcttgagcatcaccgggcaagacgagattctggacaacgtacctgttattcag
gaatcgattcgtctccgcaatccttacgtggatccgctcagctacatgcaagttcagctt
ctgacagagctgagagaactgcgtgcgaaggaagaagatgatcctgagctgctccgcgaa
gtacttcttactattaacggaattgccgctggtctgagaaacacgggctaa

DBGET integrated database retrieval system