KEGG   Prevotella jejuni: CRM71_00375Help
Entry
CRM71_00375       CDS       T05287                                 

Definition
(GenBank) alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
pje  Prevotella jejuni
Pathway
pje00500  Starch and sucrose metabolism
pje01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pje00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CRM71_00375
Enzymes [BR:pje01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CRM71_00375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C zf-UBP_var
Motif
Other DBs
NCBI-ProteinID: AUI53935
UniProt: A0A2K9HAW2
LinkDB All DBs
Position
I:85155..87293
Genome map
AA seq 712 aa AA seqDB search
MKKTNIALIGLLMGWASIANAQTVKSPNGNVAVTFSLTGNGVPTYEMTYKGKAVVKPSHL
GLELAKDKHASKGMDETSLMDGFEKTGTKTTTFDETWKPVWGETATIRNHYNELEVDLNQ
PSSKRNIVIRFRVYDDGMGLRYEFPQQPELNYFVIKEEHTQFAMAGDHTAWWLPGDYDTQ
EQETQESKLSEIRKRFHDAVNWSNSSVAVFSETGVQTSLQMKSADGLYINIHEAACANYA
TMHLNLDDKTMTFESWLTPDATGRKGFMQTPCETPWRTVMVSDDARDMLANNLILNLNEP
CKIEDTSWIHPTKYCGVWWEMIAGGKSWAYTDEFSSVKLGQTDYAHAKPNGHHPANTENV
KKYIDFAAANGLDQVLVEGWNIGWEDWFGHWKDYVFDFVTPYPDFDIKGLNEYAHSKGVK
LMMHHETSSSTQNYERHMEEAFNLMNKYGYDAVKTGYVGDIIPRGDHHYSQSMNNHYLHV
IKEAAKHHIMVNGHEATRPTGLCRTWPNLVGNESARGTEYEAFGGSDPNHTVILPFTRLQ
GGPMDYTPGILETQLSTWCNNKSYVHTTLVGQLALYLTMYSPLQMAADLPENYQKYNDAF
QFIKDVAVDWDDSRYLEAEPARYVTVARKAKGTNNWFVGGKTGIAPHLSILKLDFLDKGR
KYEATIYADAKDADYEKNPKAYTITKRTVKKGDVLKLQEVRGGGFAISLKAL
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaccaatattgcccttattgggcttttaatggggtgggcaagcattgcgaat
gcgcagacagttaagtctccaaatggtaatgttgctgtgacgttctcactaacgggaaat
ggcgtgccaacctatgagatgacttataagggtaaggctgttgttaagccttcacactta
ggtttagaattggcaaaggacaagcatgccagtaaaggaatggatgaaaccagcttaatg
gacggttttgagaagacaggaaccaagactactacctttgatgagacttggaaacctgtt
tggggagaaactgctactattcgcaaccattataatgagttggaagtagacctcaatcag
ccaagcagtaaacgtaacatagtaatccgtttccgggtctatgacgatggaatgggcctt
cgttacgagttcccacaacagccagaactgaactacttcgttatcaaagaggaacataca
cagttcgctatggcaggcgaccatacggcatggtggcttccaggagactatgacacgcag
gagcaggagacgcaggaatcaaagctatccgaaatccgcaagcgtttccatgacgctgtt
aactggagcaactcatctgttgcagtcttctcagaaacaggtgttcagacctctttacag
atgaagtctgctgacggactctacattaacattcatgaagcagcatgtgctaactacgct
acaatgcacctgaatttagacgacaaaaccatgacctttgagtcatggcttactcctgac
gctacaggacgaaagggtttcatgcagactccatgcgagactccatggcgtacggtgatg
gtcagcgatgatgcacgtgatatgcttgcaaataatctcatccttaatcttaacgaacct
tgtaagattgaagacacgtcatggatacatcctacaaagtactgtggcgtttggtgggag
atgatagctggtggtaagtcttgggcttatactgatgaatttagttcagtgaagcttggt
cagactgattatgcccatgctaagcctaacggacatcaccctgctaacaccgagaacgtg
aagaaatacatcgactttgcagctgctaacggcttagaccaagtattggttgagggttgg
aatatcggttgggaagactggttcggccactggaaggactatgtgttcgactttgttact
ccttatccagactttgatatcaagggcttgaatgagtatgctcactctaagggcgtaaag
ttgatgatgcatcacgagacttcttcaagtactcagaactatgagcgtcacatggaggaa
gccttcaatttgatgaataagtatggctacgatgctgtgaagactggctatgtaggcgat
attatcccacgtggcgaccatcactattcacagtcaatgaacaaccactacctacatgtt
attaaggaagcagctaagcatcatattatggtgaatgggcatgaagcaacacgtccaacg
ggtctctgccgtacatggccaaaccttgtcggtaacgagtcagcacgtggaacagaatac
gaagcatttggaggaagcgatcctaaccatactgtcattcttccattcacccgtcttcag
ggtggaccaatggactatacgcctggtatccttgagactcaactctctacatggtgcaat
aataagagctatgttcacacaactctcgtaggtcagcttgcgctttatctaacaatgtat
agtccacttcagatggctgccgacctcccagagaactatcagaagtataatgatgccttc
cagttcattaaggatgtagccgttgactgggatgacagccgttatcttgaggccgagcct
gcacgctacgttaccgttgctcgtaaggcgaaaggtactaacaactggttcgtaggaggt
aagactggtatcgcaccccaccttagtatcctcaaactcgacttccttgataagggcaga
aagtacgaggctaccatctatgctgacgctaaggacgctgattacgagaagaatccaaag
gcctataccatcaccaaacgcactgttaagaagggtgatgttctcaagcttcaagaggtg
cgtggaggcggtttcgccatcagcttgaaagcactttag

DBGET integrated database retrieval system