KEGG   Prevotella jejuni: CRM71_07210Help
Entry
CRM71_07210       CDS       T05287                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pje  Prevotella jejuni
Brite
KEGG Orthology (KO) [BR:pje00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CRM71_07210 (ahpF)
Enzymes [BR:pje01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CRM71_07210 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like FAD_binding_2 Thioredoxin_3 DAO Thi4 FAD_oxidored NAD_binding_8 AlaDh_PNT_C NAD_binding_7 Lycopene_cycl K_oxygenase Thioredoxin_4 Glutaredoxin FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AUI55104
UniProt: A0A2K9H917
LinkDB All DBs
Position
I:complement(1781096..1782649)
Genome map
AA seq 517 aa AA seqDB search
MLDSNILEQVKGVFASLSSDITLSVTRNSNDENSAEFSSFIEDIASTSDKVKAVYQEGEQ
FSFSILRNGEETGISFRGIPNGHEFTSLLLAVLNADGQGKNLPDEAITARIKALKGEIRL
QTYVSLTCTNCPDVVQALNVMALINPNISNEMVDGGLYQDEIQRLNIQGVPSVYINGEPL
HTGRGDLGVLLQELEDKVGTDHDANSVQTVRDYDVIVLGGGPAGASSAIYSARKGLRVAI
VAERIGGQVNDTTGIENLISVAKTTGTQLAADLRTHINEYSIDVFDNRKVVATNLKEAVK
TVSVRGGETFTAPAVVIATGASWRRLGLPDEDKYIGHGEHFCPHCDGPFYKGKDVAVIGG
GNSGIEAAIDLAGICRHVTVLEFADSMRADEVLQQKVASLTNVDVFLSTQTTALLGDGKK
LTGITVKDRTNDEERNIALDGVFVQIGLSPNSDAFRDEVEVSPRNEIVIDATNRTSLRGV
YAAGDVTTVPYKQITIAMGEGAKAALSAFDDRIRGLI
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttagattcaaacatacttgaacaggtgaagggtgtctttgcttcgctctcatctgat
ataacgcttagcgttacacgcaatagtaatgacgagaactcggctgagttctcttccttc
atagaggacatcgcttctacttccgacaaggttaaggctgtttaccaagaaggagaacag
ttctcattcagtattcttcgtaatggtgaggagacgggtatcagcttccgaggcatacct
aacggacatgagtttacctccttgctcctcgctgtacttaatgctgacggacagggtaag
aaccttcctgatgaggcgataacggctcgtatcaaggcactgaagggtgaaatacgcctt
caaacctacgtttctctcacctgtaccaactgccctgacgttgttcaggcactcaacgta
atggcacttatcaaccctaatatcagcaatgagatggttgatggggggctataccaggat
gagatacaacgtttgaacatacagggtgtaccgtcagtgtacatcaatggtgaaccatta
cacactggtcgtggcgacctcggcgtccttctccaagagttagaagacaaggttggcacc
gaccatgacgctaactccgtgcaaaccgtacgtgattatgatgttatcgtacttggtggt
ggtcctgctggagcgtcgtctgctatctattctgcccgcaaaggcttgcgtgtagctatc
gttgctgagcgcatcggaggacaggtaaacgacacgacgggtatcgagaatcttatttct
gttgctaagacgactggtacacaacttgctgctgacctccgcacacatatcaatgaatat
tcaatagatgtattcgacaatcgtaaggtggtggcaactaacctaaaggaggctgttaag
actgtctctgtaaggggtggtgaaacctttaccgcaccagctgttgtgattgcaacaggt
gcaagttggcgtcgacttgggctgcctgatgaggataaatatattggtcatggcgagcat
ttctgccctcattgcgatggtcctttctataagggtaaggacgtagcagtcatcggtggc
ggtaattctggtatcgaagcagccattgatttggctggtatttgccgccatgtgaccgtc
cttgagtttgctgactctatgcgtgctgatgaggtactacagcagaaagtggccagcttg
accaatgttgatgtgtttctctctactcagacaacagctctcttgggcgatggtaagaag
ctaacgggcattaccgtgaaggatcgtaccaatgatgaggagcgtaatatagccttggat
ggtgtctttgttcagattggtctatcgccaaacagtgatgctttcagagacgaggtggag
gttagtcctcgcaatgagattgtcattgacgcaaccaatcgaaccagtctaaggggcgta
tatgctgctggtgacgttacaacggtgccttacaaacagattacaatcgctatgggagaa
ggtgcgaaggctgccctttcagcctttgacgaccgtatccgtggtttgatataa

DBGET integrated database retrieval system