KEGG   Prevotella jejuni: CRM71_14170Help
Entry
CRM71_14170       CDS       T05287                                 

Definition
(GenBank) bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pje  Prevotella jejuni
Pathway
pje00473  D-Alanine metabolism
pje01100  Metabolic pathways
pje01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pje00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CRM71_14170
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CRM71_14170
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pje01011]
    CRM71_14170
Enzymes [BR:pje01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CRM71_14170
Peptidoglycan biosynthesis and degradation proteins [BR:pje01011]
 Precursor biosynthesis
  Racemase
   CRM71_14170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AUI56395
UniProt: A0A2N9QRR2
LinkDB All DBs
Position
II:complement(1362056..1364536)
Genome map
AA seq 826 aa AA seqDB search
MNYTIEKVTTLIGARRYGDQDANISFVLTDSRSLCFPEETLFFALKSERNDGHNYIPELY
ARGVRNFVVEVVPDDWATRYPASNFLKVVGSLEALQRLAERHRDEYLIPIVGITGSNGKT
MVKEWLYQLLSPQMIVTRSPRSYNSQIGVPLSVLLLNENTQVGVFEAGISQPGEMMALRD
IIQPTIGVFTSLGTAHQENFSSIEDKCNEKIKLFHDTEAIVYPADEEIITRCLAPYDYKG
KKLDWSVKQQQAAFFVTSIEKKDIATTVSYMWQGETKGQYKLPFIDDASIENSITCAVVS
LHLGITPAALSERMAQLEPVAMRLEVKEGQHGCTLINDSYNSDFNSLDIALDFMNRRPDH
KGRKRTLVLSDILQSGDTDKDLYNKVAFLCEKRGVEKFIGIGEGLLSQRSAFKHLREKHF
FATVNAFIHSDIFANLHDEVILLKGARQFGFDRLTELLVKKVHETVLEVNLNAVVDNLNW
YRSFLKPTTKLVCMIKADAYGAGAVEIAKTLQDHRVDYLAVAVADEGVTLRKNGITSNIM
IMNPEMTSFKTLFDYDLEPEVYSFRLLDALVKAAQKEGITGFPVHIKLDTGMHRLGFDPQ
KDMDELIKRLKHQNAIIPRSVFSHFVGSDADSFDEFSARQFALFDEGSKKLQAAFSHKII
RHMDNSSGIEHFPERQMDMCRLGLGLYGINPRTNKTINNISTLKTTILQLRNVPAGDTVG
YSRKGTIDHDSVIAAIPIGYADGLNRHLGNRHCYCLVNGKKAEYVGNICMDVAMIDVTGI
DCKEGDTVEIFGDHLPVTVLSDALDTIPYEVLTTISTRVKRVYFQD
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgaattatactattgagaaagtaacgacgctcatcggcgcacgccgttatggtgaccag
gacgcaaacatcagctttgtacttaccgacagccgttctctttgtttccctgaggaaaca
ctcttctttgccctcaagtctgagcgcaacgatggacataactatatcccagaactctat
gcaaggggcgtgaggaactttgttgtggaagtagtaccagatgattgggctacacgctat
cctgcttctaacttcttaaaggtcgttggctcgttggaagccttgcaacgactggctgaa
cgtcatcgtgatgaatacttgataccgatagtcggcatcacaggttctaacggtaagacg
atggtgaaagagtggctttatcagttgctctctccgcagatgattgtcacacgctcacct
cgtagttataattctcagataggtgttccactctctgtattgctcttgaacgagaataca
caggtcggtgtcttcgaggcgggaataagtcaaccgggcgaaatgatggctttgcgcgat
attattcagcctacgattggcgtgttcacctcccttggtacggcccaccaagagaatttc
tcttctattgaagataagtgtaacgagaagataaaactcttccatgacacggaggcgatt
gtctatcctgctgatgaagagataattacacgttgcttagcaccctacgattataaggga
aagaagctggactggtctgtaaaacagcagcaggctgctttctttgtgacgtctattgag
aagaaggacatagcgactacggtctcatacatgtggcagggagagacgaaaggacagtat
aaactaccgttcatcgacgatgccagcatagaaaactcaatcacctgcgctgtcgtctca
ctccatcttggtattacgcctgccgccctcagcgagcgaatggcacaattagagcctgtc
gccatgcgcctcgaggtgaaggagggacagcatggctgtacgcttatcaacgactcttat
aactctgacttcaactccttagacatagcactcgactttatgaaccgtcgtcccgaccat
aagggtcgcaagcgcacattggtgcttagcgacatactacagagtggtgacacggataaa
gacctatataataaggtggcattcctatgtgagaagcgtggtgttgagaagtttatcggt
attggcgagggcctgttatcacagcgttctgcctttaagcacttgagagaaaagcatttc
ttcgctacggtcaatgcctttattcatagcgacatcttcgctaacctccatgacgaagta
atcctattaaagggtgcacgacagtttggcttcgaccgactaacagaactcttggtgaag
aaggtacatgagacggtgttggaggtgaaccttaatgccgtggttgacaacctcaactgg
tatcgctctttcctcaaacctacaaccaagttggtatgtatgataaaggcggatgcctat
ggggctggagccgtagagatagccaagactttgcaagaccatcgtgtcgactatcttgct
gtggctgtggctgatgagggtgtgacactccgtaagaatggtatcacaagtaatatcatg
attatgaacccagagatgacgtccttcaagacgctcttcgactacgaccttgagcctgag
gtgtatagcttccgactcctcgatgcgttggtgaaggcggcccagaaggagggtatcacg
ggcttccctgttcatatcaagctcgatacgggtatgcaccgattagggtttgacccacag
aaggatatggacgaactcattaaacggctgaaacaccagaacgctatcatccctcgttcg
gtcttctctcactttgttggctctgatgccgatagcttcgacgagttctctgcacgtcag
tttgcgctcttcgatgaggggagcaagaagctgcaagctgccttcagccacaagatcata
cgccacatggacaactcttctggcattgagcatttccctgaacgtcagatggatatgtgt
cgattgggcttgggcttatatggtatcaaccctcgaacgaataagacaatcaacaatata
tctaccttgaagacgaccatccttcagctacgtaacgtaccggctggcgacacggtgggc
tattctcgcaagggaactatcgaccatgatagtgtgattgcggccatccctatcggctac
gctgacggtttgaaccgccatttaggtaatcgtcactgctattgtttagtgaatggcaag
aaggcagaatacgttggtaacatctgcatggatgtagcgatgattgatgtcacaggcatt
gactgtaaagaaggcgacactgttgagatcttcggcgaccaccttcctgtgaccgtcctc
agcgatgccctcgacaccatcccttacgaggttctgaccaccatcagcacccgcgtgaag
cgtgtctatttccaagactaa

DBGET integrated database retrieval system