KEGG   Paenibacillus kribbensis: B4V02_01015Help
Entry
B4V02_01015       CDS       T05249                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
pkb  Paenibacillus kribbensis
Pathway
pkb00500  Starch and sucrose metabolism
pkb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pkb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B4V02_01015
Enzymes [BR:pkb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     B4V02_01015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939 SUKH-4
Motif
Other DBs
NCBI-ProteinID: ASR45384
UniProt: A0A222WH21
LinkDB All DBs
Position
complement(235040..236533)
Genome map
AA seq 497 aa AA seqDB search
MKRNHTMMQFFEWNVAADGSHWQKLARLAPELKAKGIDAIWIPPVTKGQSPEDTGYGVYD
LYDLGEFNQKGAVRTKYGTREDLLEAVAACVRHGVTVYVDLVMNHKAGADETEVFKVVEV
NPDNRNEVISEPFDIKGWTKFTFPGRQGQYSTFQWNFEHFNGTDYDASQGRTGIYRILGK
NKSWSNHVDDEFGNYDYLMFANIDYNHQDVRREMIRWGQWLVDTLQCSGFRLDAIKHINH
EFVREFATEMIKKRGQDFYMVGEFWKPDLKSCQKFLDTIDYKIDLFDVSLHYKLYSASLG
GKDFDLSTIFEDTLVLTHPLNSVTFVDNHDSQPHEALESWVEDWFKPSAYALILLRKDGY
PCVFYGDYYGIQGKTPVKGKQAELDPLLYARYHKAYGEQKDYLDDPHTIGWVRLGVPELE
GSGCAVVVTNADNGEKRMFVGKQRAGEQWTDLTGHHNHAVTIGQDGYGVFPVRAGSVSVW
VLPTGKDSRGTEDDVEA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggaaccatacgatgatgcagtttttcgagtggaatgtcgcagcagacggttct
cactggcagaaacttgcccgcctggcaccggagctgaaggctaaaggaattgacgcgata
tggattccacctgtcaccaagggccaatcgcccgaggatacgggatacggcgtctatgac
ctttacgatctgggcgagtttaatcaaaagggtgcggtacgcaccaaatacggaaccagg
gaagaccttttggaggctgttgccgcctgcgttcgccacggcgtgaccgtctatgtcgat
ctggtcatgaaccataaggccggtgcggatgaaaccgaagtgttcaaggtcgtcgaggtt
aacccggataaccgcaatgaggttatttcagagccctttgatatcaaagggtggactaaa
tttacatttcccggccgtcaaggtcagtattccacattccaatggaattttgaacatttt
aacggaactgattatgatgcaagtcagggccggacaggaatttatcgtattttaggcaaa
aataaaagctggagcaatcatgtagatgatgaattcggcaattatgattatttaatgttt
gccaatattgactataatcatcaggatgtgcgcagggaaatgattcgctggggccaatgg
ctggtggataccttgcaatgcagcggatttcgtctggatgcgatcaagcatatcaatcat
gaatttgtacgggagtttgccacggaaatgatcaagaagcgtggacaggatttttatatg
gtgggcgagttttggaagccggatctgaaatcgtgccagaagttcctggataccatcgat
tataaaatcgacctgttcgacgtatccctccactacaaactatatagcgcttccttgggt
ggcaaggatttcgatctaagcaccattttcgaggacacgctggttcttacccacccctta
aactcggtcacttttgtcgataaccatgattcccagccccatgaagcgctcgaatcctgg
gtagaggactggttcaagcccagcgcctatgcgctcattttgctgcgcaaggacggttac
ccctgcgtattctacggggattactacggcattcaggggaaaacacccgtgaaaggcaag
caggctgagttagatccgctcctgtatgcccgctaccataaagcctatggagagcaaaag
gattatttggatgatccccatacgattggatgggtgcgtctgggtgtccctgaattggaa
ggctccggctgcgctgtagtggtcaccaatgcagacaacggagaaaagcgcatgttcgta
gggaagcagcgcgcaggagagcaatggactgatttgacgggacatcacaatcacgccgta
acgatcgggcaggacggctacggcgtatttccggttcgcgccggcagcgtatcggtatgg
gtacttcccactggaaaagacagccggggaacagaagacgacgtggaagcttaa

DBGET integrated database retrieval system