KEGG   Paenibacillus kribbensis: B4V02_02200Help
Entry
B4V02_02200       CDS       T05249                                 

Definition
(GenBank) flagellar protein
Organism
pkb  Paenibacillus kribbensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_19 HTH_3 HTH_24 DZR RPA_C zinc-ribbons_6 NMD3 PolC_DP2 C1_2
Motif
Other DBs
NCBI-ProteinID: ASR45603
UniProt: A0A222WIH9
LinkDB All DBs
Position
495718..496128
Genome map
AA seq 136 aa AA seqDB search
MNLDNCPRCGKLFIMNVRGICQNCIKEIELEYERCVKHIRENKGINMHELSDATGVSVKQ
ITTFIREGRISIANAPNMTYPCEVCGIPIREGHMCDSCRTRLTKDLHQAARESSNQEQSN
NMGKGAYSAIDKLREK
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgaatttggataactgtccccgctgtggaaagctgtttattatgaatgtcagaggaatc
tgccagaattgtattaaagaaatcgagcttgaatatgagcgctgcgtcaaacatatacgt
gaaaataaagggattaatatgcatgagctttctgacgctactggggtatccgttaagcaa
atcacaacatttatacgtgaggggcgcatttccattgctaatgcacccaatatgacgtat
ccttgcgaagtatgcggaataccgattcgtgaaggacacatgtgcgattcttgtcgaaca
agactgaccaaagacctgcatcaggccgcgcgtgaaagcagtaatcaggagcaaagtaac
aatatgggcaaaggtgcctacagcgcaattgataaactccgtgaaaagtag

DBGET integrated database retrieval system