KEGG   Paenibacillus kribbensis: B4V02_02865Help
Entry
B4V02_02865       CDS       T05249                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
pkb  Paenibacillus kribbensis
Brite
KEGG Orthology (KO) [BR:pkb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pkb03012]
    B4V02_02865
   03029 Mitochondrial biogenesis [BR:pkb03029]
    B4V02_02865
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pkb04147]
    B4V02_02865
Translation factors [BR:pkb03012]
 Eukaryotic Type
  Elongation factors
   B4V02_02865
 Prokaryotic Type
   B4V02_02865
Mitochondrial biogenesis [BR:pkb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    B4V02_02865
Exosome [BR:pkb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   B4V02_02865
  Exosomal proteins of breast cancer cells
   B4V02_02865
  Exosomal proteins of colorectal cancer cells
   B4V02_02865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ASR45725
UniProt: A0A222WHQ7
LinkDB All DBs
Position
658617..659807
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHVNIGTIGHVDHGKTTLTAAITTVLSKTYGGAAVAFDQIDKAPEERERG
ITISTAHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKCDMVEDEELLELVEMEVRDLLSEYEFPGDDTPITRGSAREALQ
NPEGDWAKKIVEMFETIDTYIPTPERDTDKPFLMPVEDVFSITGRGTVATGRVERGTVKV
GDEIEIIGIQEESRKSVVTGVEMFRKLLDSAQAGDNIGALLRGVDRAQIERGQVLAKPGS
VNPHTEFSAQIYVLTKEEGGRHKPFFTGYRPQFYFRTTDVTGIITLPEGSEMVMPGDNIT
VTVQLISPIAIEEGTKFSIREGGRTVGAGAVATISK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggctaagtttgaacgtaacaaaccgcacgttaatatcggtactattggtcac
gtcgaccatggtaaaacaactttgactgctgcaatcacaactgtactttccaaaacttac
ggtggtgctgctgtagcgttcgaccaaatcgataaagctccagaagagcgcgaacgcggt
atcacaatctccacagcacacgtggaatacgaaacacctaatcgtcactatgcacacgtt
gactgcccaggtcacgccgactatgttaaaaacatgatcactggcgctgcacaaatggac
ggagcgattctggttgtatccgcagctgacggcccaatgccacaaactcgcgaacacatc
ctgttgtcccgtcaagtaggcgttccttacatcgttgtattcctgaacaaatgcgacatg
gttgaagacgaagaattgttggaactggttgaaatggaagttcgcgacttgctgagcgag
tacgaattcccaggcgacgacactccaatcactcgtggttccgctcgtgaagcactgcaa
aacccagaaggcgactgggctaagaaaatcgttgaaatgttcgaaacaatcgacacttac
atcccaactccagaacgcgacactgacaagcctttccttatgcctgtcgaggacgtattc
tccatcactggtcgtggtacagttgctacaggccgtgtagagcgtggtactgttaaagtc
ggcgacgaaatcgaaattatcggtattcaagaagaatcccgtaaatccgttgtaacaggc
gttgaaatgttccgcaaattgcttgactctgctcaagctggtgacaacatcggcgcactg
cttcgcggtgtagatcgcgcacaaatcgagcgtggccaagtattggctaaaccgggttct
gttaatccacatacagaattctctgctcaaatctatgttttgactaaagaagagggtgga
cgtcacaaacctttcttcaccggataccgtccacagttctacttccgtacaactgacgtt
actggtatcatcactttgccagaaggttccgaaatggtaatgcctggcgacaacattacg
gttactgttcaactgatcagcccaatcgcgattgaagaaggaactaagttctccattcgt
gaaggcggtcgtacagttggtgccggtgccgtagcaacaatctctaaataa

DBGET integrated database retrieval system