KEGG   Paenibacillus kribbensis: B4V02_03165Help
Entry
B4V02_03165       CDS       T05249                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pkb  Paenibacillus kribbensis
Pathway
pkb00620  Pyruvate metabolism
pkb00680  Methane metabolism
pkb01100  Metabolic pathways
pkb01120  Microbial metabolism in diverse environments
pkb01200  Carbon metabolism
Module
pkb_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pkb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B4V02_03165
  Energy metabolism
   00680 Methane metabolism
    B4V02_03165
Enzymes [BR:pkb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     B4V02_03165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ASR45768
UniProt: A0A222WID2
LinkDB All DBs
Position
692155..694947
Genome map
AA seq 930 aa AA seqDB search
MTELTLTANKNQSNNLLRRDVRFLGNILGEVLVHQGGNELLDIVEKIRETSKSLRAGYQP
ELYENFKQMVSGLDTDIRHQVIRAFAIYFQLVNIAEQNHRIRRKRDYEHSAGEDVQRGSI
ESSVQELKQGGFSAEDVSNMLKELSLELVMTAHPTEATRRVILDIHKRISEDVMLLDNPM
LTLREREQVRENLLNEVITLWQTDELRDRKPTVLDEVRNGMYYFHETLFHVLPDVYQELE
RCLSKYYPEQKWHIPTYLRFGSWIGGDRDGNPSVTSHVTWETLRMQRKLALREYQHTLKE
LMGYLSFSTSIVRVSDDLLASIEEDRSHITLKKMEVWHNEKEPYRIKLAYMIAKVNNILD
ENKQDTRERYSTAEELIADLNVIDNSLRHHFADYVADTYIQKMIRQVELFGFHTATLDVR
QHSQEHENAMTEILSKMNIVSDYGKLPEEEKIDLLEKLLNEPRPITSPYLKYSDNTQECL
DVYRTIYMAQKEFGKQSITSYLISMTQGASDLLEVMVLAKEVGLFRIEKDGTVICTLQSV
PLFETIDDLHAAPSIMRRLLNLPVYRQSVAAMDQLQEIMLGYSDSNKDGGVVTANWELRV
AMNSITEVVNEFGVKVKFFHGRGGALGRGGMPLNRSILAQPPHTIGGGIKITEQGEVLSS
RYSLKGIAYRSLEQATSALITAAAYHRSGQKEVFEESWEEIIARISEVSLKKYQDLIFRD
PDFFAFFKESTPLPEVGELNIGSRPSKRKNSERFEDLRAIPWVFAWTQSRYLLPAWYAAG
TGLQSFYQNNEDNLKVLQTMFRDSAFFRSLIDTLQMAIAKADLLIAEEYAGMSDNEEARE
RIFGQISEEFKLTSELILKITGQSEILDDVPVIQESIRLRNPYVDPLSYLQVQLLSELRE
LRDQNGDDAELLREVLLTINGIAAGLRNTG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcttacgttaaccgcaaacaaaaaccaatccaataatctgctgcggcgggac
gttcgttttctaggaaatattcttggtgaggttttggttcatcagggtggcaacgaactt
ttggatatcgtggaaaaaatacgtgagacaagtaaatcgttacgtgccgggtatcagccg
gagttgtacgagaatttcaaacaaatggtcagcggactggatacggatattcgtcaccag
gttattcgcgcgtttgcgatttattttcagttggtgaatatcgctgagcaaaatcatcgt
attcgtcgtaagcgggattatgagcattccgctggtgaagatgttcaacgcggctctatt
gaaagttccgttcaggagcttaagcaagggggattctctgccgaggacgtcagtaatatg
ctgaaagagctctctctggaactggttatgaccgcacatcctacagaggcaacacgacgg
gtaattctggatattcataagcggatttctgaggatgtcatgctgctggacaatccgatg
cttaccttgcgcgagcgggaacaggtgcgggagaatctgctgaatgaagtaattacactg
tggcagacagatgagctgcgtgaccgcaagccaactgtattagatgaagtaagaaatggg
atgtattattttcatgagactttgtttcatgtattgccggatgtataccaagaattggaa
cgatgtttaagcaaatattatcccgagcaaaaatggcacattccaacctacctgagattt
ggctcctggattggtggggaccgagacggcaatccgtctgtgacatctcatgtaacttgg
gaaacgttacgtatgcaacgcaagctggctctgagagaatatcagcacacactgaaagaa
cttatgggatacttgagctttagcactagcattgtgcgcgtttcagatgatctgctggct
tctattgaagaagatcgttcacatattacgctcaaaaagatggaagtatggcataacgaa
aaagagccttatcggattaaactcgcatatatgattgccaaggtgaataacattttggat
gaaaataaacaggacaccagggaacgttatagcactgctgaagagcttattgcagacctg
aatgttattgataacagtttgcgtcatcattttgcggattatgtggcagatacgtatatt
caaaagatgattcgccaggtagagctattcggattccatacagctacactggatgtacga
cagcatagtcaggagcatgaaaatgcgatgactgagattctttccaaaatgaatatcgtg
tcagattacggtaagttgccggaggaagaaaagatagatctgctggaaaagctgttgaac
gaaccccgtccaattacttcgccgtatttaaaatatagcgataacacgcaggaatgtctt
gacgtatatcgcacgatatatatggctcagaaggaatttggcaagcagtccattacaagc
tacctcatcagtatgactcagggagccagtgacttgctggaggttatggtgctagccaaa
gaagtgggactgttccgcatcgaaaaggatggtactgtcatatgtacactgcaatccgtt
cctttgtttgaaacgatagacgatctgcatgctgcaccaagtattatgagaagattgttg
aacttgcctgtatatcgacaatctgtagccgcaatggatcagcttcaggaaatcatgctg
ggctactcggacagtaacaaggatggcggggtggttacggccaactgggagcttcgggtc
gcgatgaacagcattacagaagtggttaatgagtttggcgtaaaagtgaagttctttcac
ggtcgtggtggagcactgggccgcggaggaatgccgcttaaccgcagcatcctggctcag
cctcctcatacgattggaggcgggatcaagattacggagcagggtgaagtgctctcatcc
cgatactcgctcaaaggcattgcttatcggagtcttgagcaggcgacctcagccttgatt
acggctgctgcgtatcatcgctccgggcagaaggaagtgtttgaggaaagctgggaggag
atcattgcccgtatttccgaggtatccctgaagaagtatcaggatttgattttccgagat
ccggatttcttcgctttcttcaaagaatcgacgccgttgcctgaggtgggcgagctgaat
attggatcacgtccgtcgaagcgtaagaacagcgagcgttttgaggacttgcgcgccatt
ccatgggtttttgcatggacacaaagtcgctacttgttacctgcatggtatgcggctgga
acaggtctgcaaagcttttatcagaacaatgaggataatctcaaggtactgcaaacgatg
tttagggactcggctttcttccggtcccttattgatacgctgcaaatggcgattgccaaa
gcggatttgctgattgccgaggaatatgcgggaatgtccgataatgaagaggcaagagag
cgtattttcggacagatttcagaggagttcaagcttacatccgagctgattttgaaaata
accggacaatccgagattttggacgacgtgccggtgattcaggaatcaatcaggttacgt
aatccttatgtcgatccgttaagttatctgcaggttcagttgcttagcgagctacgggag
ctgcgtgatcaaaatggagatgatgctgagctgttgcgtgaggtattattgaccattaac
ggaattgccgcgggattaaggaacacaggctga

DBGET integrated database retrieval system