KEGG   Paenibacillus kribbensis: B4V02_06620Help
Entry
B4V02_06620       CDS       T05249                                 

Definition
(GenBank) haloacid dehalogenase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
pkb  Paenibacillus kribbensis
Pathway
pkb00630  Glyoxylate and dicarboxylate metabolism
pkb01100  Metabolic pathways
pkb01110  Biosynthesis of secondary metabolites
pkb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pkb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    B4V02_06620
Enzymes [BR:pkb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     B4V02_06620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Hydrolase_3 Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: ASR46374
UniProt: A0A222WK94
LinkDB All DBs
Position
1469876..1470655
Genome map
AA seq 259 aa AA seqDB search
MSELIVQGERYSCRGILLDKDGTLLDFIQLWGPWARSILDMMEQHLALSGTGFTVAKDSV
LGTIHDREGRVIGYDPSGPLAMGTVDESTGVLAWQLYAAGVPWNEAVRLVRDFNKTAMAD
IRRQRAAKVFPGLRTLLEQSRRAGVKLAVVTSDSTEAAQEHLEWMGLTSYFDEVIGHDRV
TYGKPDPEMAEKACALLGLPPSDVVVIGDSNGDMQMGKRAGVRLAIGFAPEPERSAHLLD
ADMVIRAYEELEVRETWTK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagctgatcgtacagggggagcggtattcgtgccgtggcattttgttggataag
gatggcacgctgctggattttattcagttgtggggcccttgggctcgttctatactggat
atgatggagcagcaccttgccttgtcaggtaccggttttacagtggcaaaagatagcgtt
ctgggcacgattcatgaccgggaggggcgcgtgatcggctatgatccttccggtccgctg
gctatgggaacggtggatgaaagtacgggcgtactcgcttggcagctgtatgctgctggc
gtgccgtggaatgaggctgtgcggcttgtccgtgattttaataaaacagcgatggctgat
attcgaagacagcgggcagcgaaggtgtttccggggttgcggacgttgctggagcaaagc
cgccgtgccggggtgaagctggcggttgtaacctctgacagtacagaggccgcacaggag
catttggaatggatggggctgacctcctattttgacgaggtcattggacacgatagggtt
acatacggcaagcctgacccggaaatggctgaaaaagcctgcgctttactgggactacca
ccatcggatgtagttgtcatcggagacagcaacggggatatgcagatgggcaagcgtgcc
ggagtacggctggctattggatttgcgccggagcccgaacgttcggctcatttgctggat
gcggacatggttatccgcgcatatgaagaactggaggtgcgtgaaacatggacaaagtaa

DBGET integrated database retrieval system