KEGG   Paenibacillus kribbensis: B4V02_21665
Entry
B4V02_21665       CDS       T05249                                 

Definition
(GenBank) sucrose phosphorylase
  KO
K21350  sucrose 6(F)-phosphate phosphorylase [EC:2.4.1.329]
Organism
pkb  Paenibacillus kribbensis
Brite
KEGG Orthology (KO) [BR:pkb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B4V02_21665
Enzymes [BR:pkb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.329  sucrose 6F-phosphate phosphorylase
     B4V02_21665
SSDB
Motif
Pfam: Alpha-amylase
Other DBs
NCBI-ProteinID: ASR49117
UniProt: A0A222WR90
LinkDB
Position
complement(4860534..4862003)
AA seq 489 aa
MAVKNQVQLITYPDSLGGDLKTLNQVLLNYFTDIFKGGVHILPPFPSSGDRGFAPLSYLE
IEPAFGTWKDIKAIGENFDVLVDLMVNHISRQSEYFQDFLKKGRKSEYVDLFITLDKVWE
DGNPVQDDINKMFLRRSLPYSTFTIEETGEEEKVWTTFGKTDPSEQIDLDIKSKKVKQLI
TDFFLNFKENNVKIVRLDAVGYVIKKLGTSCFFVEPEIYEFLDWVLELAKSLDIEILPEV
HSHYTIQNKLSEHGYWIYDFILPYRILDTLINKSSIALIDYLKNRPHNQFTMLDCHDGIP
VKPDLDDLIDTTEARKLVDVCLQRGSNLSLILSDEHKSKDGFDVHQIRCSYYSVLNNDDD
AYISARAIQFFTPGIPQVYYVGLLAGENDYERVRETGEGREINRHNYSLMEIEKSLEKEV
VKRLLKLIRFRNDYDAFNGEFKVLESNKDEIYLSWEKDKKRCTLYIDFKTNRPVIDYIDQ
DGKYIQYYV
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggcagtgaaaaatcaggtacagttaattacctaccccgattctttgggaggtgattta
aagactcttaatcaagtacttctaaattattttacggatatttttaaaggaggagtgcat
atccttccaccgtttccctcttcaggagaccgtggatttgctccattatcctatttagaa
attgaaccggcctttgggacttggaaggatattaaagctattggcgaaaactttgatgtt
ttagtagatttgatggttaatcatatatctagacaatctgaatattttcaggattttcta
aaaaaagggagaaaatctgaatatgtagatttgtttattacattagataaggtttgggaa
gatggaaatcctgttcaggatgacattaataaaatgttcctacgacgttctctaccatat
tctacttttacaattgaggaaactggtgaggaagaaaaggtatggacgacatttggaaag
acggatccttcagaacaaattgatttagatattaagtcaaaaaaggtaaaacagctaatt
acggacttctttttaaactttaaggaaaataatgtgaagattgtccgtctggatgcggtt
ggctatgttattaaaaaattgggaacaagttgtttttttgtagaacccgaaatctatgag
ttccttgattgggtcttagaactggctaagtcattagatattgaaatattaccagaagtt
cattcacattacactatccaaaataagctgtccgagcatggatattggatctacgatttt
attttaccttatcgaattttggatactttaatcaataaatctagtatagcccttattgat
tatcttaagaatcgaccacataatcagtttacaatgctggactgccatgacggtatacca
gtaaaaccagacttagatgatcttattgatacaacagaagctagaaaattggtagatgtt
tgcctccaaagaggttcaaacctaagtctaattttgtcagacgagcataagtcgaaggat
ggatttgatgtccatcaaatcagatgctcatactactccgtactaaataatgatgatgat
gcctatatttcagcgagagcgattcaattctttactccagggatacctcaggtgtattat
gtaggactattagctggggaaaacgactatgaaagagttagagaaacaggagaaggtaga
gaaatcaaccgtcacaactatagtcttatggagattgaaaaatctctagaaaaagaagta
gtcaaaagattattaaagcttattcgctttagaaacgattatgatgcctttaatggggag
ttcaaggtattagaatccaacaaagatgaaatttatctttcctgggaaaaggacaagaag
cgttgtacactttatatcgattttaaaacgaacaggcctgttatcgattatattgatcaa
gatggtaaatatatacaatattatgtataa

DBGET integrated database retrieval system