KEGG   Paenibacillus kribbensis: B4V02_22980Help
Entry
B4V02_22980       CDS       T05249                                 

Definition
(GenBank) histidine kinase
Organism
pkb  Paenibacillus kribbensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c Response_reg His_kinase HisKA 7TMR-DISM_7TM HATPase_c_3 HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: ASR49365
UniProt: A0A222WTR1
LinkDB All DBs
Position
complement(5156082..5159153)
Genome map
AA seq 1023 aa AA seqDB search
MNKRRFFLITLSFLIVIIGLRLLWFDYYHNQDYPRAKAGILDLRGLNLQEIKTLPLNGEW
EFYPGTLSSPAELKSLSMKKQRQTIQVPGLWSESVSPVDHKAYGVGTYRLLILSDRSEDT
LYGLRIGRISTASNIFVNGRLVSHSGQVSNKVEQHTGSTVPFSAMFDTNRQAIEIVIQVS
NFDFPSNGGIVKPIIFGSAEAVNSRTNFAISMQIMVCIILLLHGLYVVVIFFMNPQKKAL
LYFAGIVVCTVISILTDDDKLLIDWFPISLSLSVKITILSYIGIGMCVLKLAQSLLARSR
IIQIVFIAHCCFAVTVLFASTSNLYAFLLALIAFSGITLCATVPAVAFLRTFRGQKEAVF
LLLASLSIASSILWGMFKTNDLPYYPWDIVLAFVAFASYWFKRFFNTNAELRRLTERLQR
ADQVKNEFLANTSHELRNPLHGMINIAQTVLENQNSALDEPNKRNIQLLVTVGRRMSLLL
NDLLDVTRLREKDILLEKRSLKPQAVVSGVLDMLQFMTDGKPLNMVVNIPADFPNVLADE
NRVIQILFNLLHNAVKYTAEGSISVHAHIQGEMAGIEVRDTGVGMDEETQKRIFHPYEQG
NSHLTVIGDGLGLGLSISKQLVELHGGSLSVSSELGQGSTFSFTLPLDPSPIPVQSRDNE
QVCMDEEAGTDFIALQNEAVMQVAAGSARSAILAVDDDPVNLRVLEGILASESESYDLVT
VTSAQEALHRLDYRDWDLIIADVMMPQMSGYELTRRVREYFSISELPVLLLTARSQQEDL
YTGFLAGANDYIMKPVDSMELKSRVRALTDVKKSAREQLWMEAAWLQAQIKPHFLFNTLN
TIASLSHVDHARMVKLIEEFGKYLRSSFNPQNLDRVVSLEYELVLLKSYLYIEKERFGNR
LDIVWEVDEQVSLLLPPLSIQPLAENAIRHGIMNRIDGGTLCIRIQHQEDGTEIAIMDDG
VGMSQEELDRLLDPQQEQHSGIGLRNTDRRLKQVFGKGLYISSHPNQGTTVSFHVPRAQR
QET
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atgaataagcggagattttttttaattacgctgtcattcctgatcgtaattatcggtctg
cgtttgctgtggtttgattattaccacaatcaggattatccccgggccaaggcgggaatt
ctggatctgagggggttgaatttgcaggagataaagaccctgccattaaatggtgagtgg
gagttttatccgggaacattatcttcccctgctgaactgaagtccttatctatgaagaag
cagcgtcagaccattcaggtgccgggattatggagtgagtcggtatctcctgtggatcat
aaggcatatggggttggaacctatcggctgcttattttgagtgacaggtcggaggacact
ttatacggacttcggatcgggaggattagtacggcatccaacatatttgtgaacggccgt
ttagtcagtcatagtggtcaggtctctaacaaggtcgaacagcatacaggatcaaccgtt
ccgttctctgctatgtttgatacgaacaggcaggctattgagattgtcatccaagtatcc
aattttgattttccttccaatggagggattgtgaagcctatcattttcggaagcgcggag
gctgtgaatagccgaaccaacttcgcgatctcgatgcaaattatggtatgtattatttta
ctgcttcacgggttatatgtagtcgttatattttttatgaatccacaaaagaaggcgctt
ctgtatttcgcgggaattgtagtctgcacggtaatatccatcctgacagacgatgacaag
cttttaatagactggttccctatcagtttgagtctttcggtaaagataaccatactttcc
tatattgggataggcatgtgtgtactgaagctggcgcagtctctgttggctcgatcccga
atcattcagattgtttttatagcccactgttgttttgcggtcacggttttatttgcatct
acatccaacctttatgcatttttgttggctcttatcgcattctcaggcattaccctatgt
gctacggttcccgcggttgcttttcttagaacattcagagggcaaaaagaggctgttttt
ctgttgctggcatcccttagcatcgcatccagcatactgtggggtatgttcaaaacgaat
gacctcccttattacccttgggatattgtgctggcctttgtggcgtttgcgtcctattgg
ttcaaacggttttttaatacgaacgccgagctgagaaggctgacggagagattgcagcgc
gctgatcaggtgaaaaatgaatttttggccaacacctctcatgagctgcggaatcctctg
catgggatgatcaatatagcacagaccgtgctggagaatcagaatagcgccctggacgaa
cccaacaagagaaacatacaattgctcgttacggtcggtcgccgtatgtccttattattg
aatgatttgctggatgttacacgtctgcgtgaaaaggatattcttctggaaaaaagaagc
ttgaagcctcaggctgtagtctcgggtgtgttggatatgcttcaattcatgacagatggt
aaaccgttaaacatggtagtaaacatccctgctgattttccgaatgtattagcagatgaa
aaccgggtaatccaaatcctgttcaatctccttcacaatgcggtcaaatatactgccgag
ggatcaatttccgttcacgcacacatccagggcgaaatggccggtattgaggttcgtgac
actggcgttgggatggatgaggagacgcaaaagcgaatatttcatccatatgaacaagga
aattctcatttgacggttattggggatgggcttggactagggttgagcatcagcaagcaa
ttggtggagcttcatgggggatctctgagtgtaagctctgaacttggtcaaggctcaacc
ttttctttcacgctaccgctcgatccctcacctatcccggtccaatcacgagataacgag
caggtgtgtatggatgaagaagcaggtactgattttatagctttgcagaatgaagcagtg
atgcaggttgctgcaggctctgcacggtctgccatactcgcggtagatgatgatccggtt
aatttaagggtgttggagggcattcttgcctcggaatcggagtcttatgatcttgtcact
gtaaccagtgcccaggaggccttgcataggttggattatcgggattgggatttaattata
gccgatgtcatgatgccccaaatgtcgggttatgagttaactcggcgtgtgagggaatac
tttagtatttccgagctgcctgtgttgctgttgacggcacgtagtcagcaggaggactta
tatacgggatttcttgccggggccaacgattatattatgaagcctgtggattccatggaa
ttgaaatccagggtccgtgccttgactgatgttaaaaagtccgcaagggaacagctttgg
atggaggctgcatggttacaggcgcaaatcaaacctcattttttgtttaacaccttgaat
accattgcatccttgagtcatgtggatcacgccagaatggtgaagcttattgaagagttc
ggcaaatatttaagatcaagcttcaatcctcaaaatcttgatagagtcgtatcactggaa
tacgagcttgtactcctgaaatcttatctttatatagagaaggagcgttttgggaataga
ctagatattgtatgggaagtagatgaacaggtgtccttgcttctgccgccgttgtccatt
cagccacttgcggaaaatgcgatcaggcatggtatcatgaatcggatagatggaggaaca
ttgtgcattcgaattcagcatcaggaggatggcacagaaatagccattatggatgacggt
gtgggcatgagtcaggaggaactggatcgtctgctggatcctcagcaagaacagcatagc
gggattggattacgtaatacggaccgacgtctgaagcaagtattcggtaaggggctgtat
attagtagtcatcccaatcagggtacaacggtgagcttccatgttccccgggcacaaagg
caagaaacttaa

DBGET integrated database retrieval system