KEGG   Paenibacillus kribbensis: B4V02_24375Help
Entry
B4V02_24375       CDS       T05249                                 

Definition
(GenBank) bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
pkb  Paenibacillus kribbensis
Pathway
pkb00340  Histidine metabolism
pkb01100  Metabolic pathways
pkb01110  Biosynthesis of secondary metabolites
pkb01230  Biosynthesis of amino acids
Module
pkb_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:pkb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    B4V02_24375
Enzymes [BR:pkb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     B4V02_24375
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     B4V02_24375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: ASR49597
UniProt: A0A222WST6
LinkDB All DBs
Position
complement(5454496..5455239)
Genome map
AA seq 247 aa AA seqDB search
MSNELNEQLSLEQILDNIRWNEAGLVSAIVQDDATLQVLTLAYMNRESLKLSLELGETWF
WSRSRQELWHKGATSGNTQKITSIQLDCDGDALLVRVIPNGPACHTGATSCFSREISAPG
TALVSATGNAAAGQAEEVETGGTANAAANRFEVLAQLEAIIKEREETRPEGAYTTYLFDK
GVDKILKKVGEEASETIIAAKNKDNEELRLEVSDLIYHLLVLLQERKLPLDDVLAELNRR
HERPRRD
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgaattaaacgagcagctatctctggagcagatattggataatatccgctgg
aatgaagcgggacttgtctcagccattgtacaggatgatgctacgcttcaggtgctgacc
ctggcttatatgaaccgcgagtcgctgaagctgtctctggaattgggagagacctggttt
tggtctcgttccagacaggagctgtggcataagggggcaacctccggcaatacgcaaaaa
atcacctccatccagctggattgtgacggtgatgctctgcttgtgcgtgtcattccgaac
ggtcctgcctgtcatacaggagcgacgagctgcttttcccgtgagatttctgctccggga
acggctctcgtatctgccactggcaatgcagcggcggggcaagcagaggaggtagagacg
ggtggaacggccaacgctgcggcaaaccgctttgaggtgcttgcccaattggaggcgatc
attaaggagcgcgaagagacacgccccgaaggagcctacacgacctatctttttgataaa
ggcgtagacaaaatcctgaaaaaggttggcgaggaagcttccgagacgatcattgccgcc
aaaaataaagataatgaggagctgcgtctggaggtcagcgatttaatttatcatctgctg
gtgctgctgcaagagcgcaagctgccactggatgatgtgctggctgagctgaatcgtcgt
catgagcgtcctcgtcgtgattaa

DBGET integrated database retrieval system