KEGG   Pseudomonas knackmussii: PKB_0887Help
Entry
PKB_0887          CDS       T03081                                 

Gene name
sodB
Definition
(GenBank) Superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pkc  Pseudomonas knackmussii
Brite
Enzymes [BR:pkc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PKB_0887 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CDF82253
UniProt: A0A024HCP7
LinkDB All DBs
Position
complement(920028..920609)
Genome map
AA seq 193 aa AA seqDB search
MAFELPPLPYAKNALEPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKSLEDIVKTS
SGGIFNNAAQVWNHTFYWNCLSPNGGGQPTGALADAINAAFGSFDKFKEEFTKTSVGTFG
SGWGWLVKKADGSLALASTIGAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN
LVNWDYVAQNFAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgccgccgctgccttacgcgaagaatgcccttgagccgcacatttcg
gcggaaaccctggaataccaccacgacaagcaccacaacacctacgtcgtgaacctgaac
aacctggtccccggcaccgaattcgaaggcaagagcctggaagacatcgtcaagacctct
tccggcggcatcttcaacaacgcggcccaagtgtggaaccacaccttctactggaactgc
ctgagccccaacggcggtggccagcccaccggcgccctggctgatgccatcaacgccgcc
ttcggttccttcgacaagttcaaggaagagttcaccaagacttccgtcggcaccttcggt
tccggctggggctggctggtgaagaaggccgacggctccctggccctggccagcaccatc
ggcgccggctgcccgctgaccagcggcgacaccccgctgctgacctgcgacgtatgggaa
cacgcctactacatcgactaccgcaacctgcgtccgaagtacgtagaagcgttctggaac
ctggtgaactgggactacgtagcgcagaacttcgctgcctga

DBGET integrated database retrieval system