KEGG   Pseudomonas knackmussii: PKB_3823Help
Entry
PKB_3823          CDS       T03081                                 

Definition
(GenBank) putative D-alanyl-D-alanine carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
pkc  Pseudomonas knackmussii
Pathway
pkc00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pkc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PKB_3823
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pkc01002]
    PKB_3823
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pkc01011]
    PKB_3823
Enzymes [BR:pkc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     PKB_3823
   3.4.21  Serine endopeptidases
    3.4.21.-  
     PKB_3823
Peptidases [BR:pkc01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   PKB_3823
Peptidoglycan biosynthesis and degradation proteins [BR:pkc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   PKB_3823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: CDF85160
UniProt: A0A024HJF6
LinkDB All DBs
Position
4004465..4005907
Genome map
AA seq 480 aa AA seqDB search
MFKSVRVLALAALLPFAVPTLAAPINTSLPPRVEKALKASKLDNNSLSLVKIPLDGPGVP
TYFNADVSVNPASTMKLFTTYAALELLGPTYQWKTEFLTDGKLSDGVLNGNLYLKGGGDP
KLNLEKLWLMMRDLRANGVLKVTGDLIVDNSYFVQPQLPVFNDDGNDDNKPFLVGPDAAM
VNLKSVRLVVRGESNQATVTMDPPLANVRIENTIKITAPANCPAWPKLRFIPETRPDGTV
LAAGGEIPRGCSAQTYMSLLDHPAFTAGAVRGIWQELGGSIAGRDRQGSVPKNATVLSRA
MSPDTVEIIRDINKYSNNTMARQVFLSIGAQNRTSADGDDGKAAQRVIRQWLARKGITAT
HLVMENGSGLSRDERVSAREMAAMLQAAWHSPYAAEYISSLPIVGVDGTMHKRLKHTPMT
GEAHVKTGTLNTVRALAGFSRDAKGNNWVVVAILNSNRPWGASSILDQVLLDLYASTRDQ
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaatccgtgcgtgttcttgccctcgccgctctgctgccattcgccgtgccgacc
ctggccgctccgatcaacaccagcctgccgccgcgagtcgaaaaagccctcaaggccagc
aagctcgataacaattccctgtccctggtgaagattccgctggacggaccgggcgttccc
acctatttcaatgccgacgtctcggtgaatccggcttcgaccatgaagctcttcaccacc
tacgcggcacttgagctactcggcccgacgtaccagtggaagaccgagtttctcaccgac
ggcaaactcagcgacggtgtgctcaacggcaacctctacctcaagggcggcggcgatccg
aaactgaacctggagaagctctggctgatgatgcgcgacctgcgcgccaacggcgtgctc
aaggtcaccggcgatctgatcgtcgacaacagctacttcgtccagccgcagctgccggtg
ttcaacgacgacggcaacgacgacaacaagccgttcctggtcggccccgacgcggccatg
gtcaacctgaagagcgtgcgcctggtggtccgtggcgaaagcaaccaagcgactgtgacg
atggacccaccgctggccaacgttcgcatcgagaacacgatcaagatcaccgccccggcc
aattgcccggcctggccgaagctgcgcttcatcccggaaacgcgcccggacggcaccgta
ctcgccgccggcggcgagattccgcgcggttgcagcgcacagacctacatgtcgctgctc
gaccacccggccttcaccgccggcgccgtgcgaggcatctggcaggagctgggcggcagc
attgccggtcgcgaccgccagggcagcgtgccgaagaacgctaccgttctgtcccgagcc
atgtcgccggacaccgtcgagatcattcgcgacatcaacaagtacagcaacaacaccatg
gcgcggcaggtcttcctgagcattggcgcgcagaaccgcaccagcgccgacggtgacgat
ggcaaggcagcgcaacgcgtaatccgccaatggctggcgcgtaaaggcatcaccgccact
cacctggtgatggagaacggctccggcctgtcgcgtgacgagcgggtcagtgcccgcgag
atggccgccatgctgcaggcggcctggcatagcccctacgcggcggaatacatctcctcg
ctaccgatcgttggcgtcgacggcaccatgcacaagcgcctgaaacacacgcccatgacc
ggcgaggcccacgtcaagaccggcaccctcaacacggtgcgcgccctggctggcttcagc
cgcgacgccaagggcaataactgggtggtggtggcgatcctcaacagcaaccgtccctgg
ggcgcttcgtcgatcctcgaccaggtgctgctcgacctctacgcctctacccgcgaccaa
tga

DBGET integrated database retrieval system