KEGG   Pseudomonas knackmussii: PKB_5770Help
Entry
PKB_5770          CDS       T03081                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pkc  Pseudomonas knackmussii
Brite
KEGG Orthology (KO) [BR:pkc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PKB_5770 (ahpF)
Enzymes [BR:pkc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PKB_5770 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_oxidored DAO AlaDh_PNT_C Glutaredoxin FAD_binding_3 K_oxygenase Thi4 FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: CDF87075
UniProt: A0A024HPW2
LinkDB All DBs
Position
6104428..6105993
Genome map
AA seq 521 aa AA seqDB search
MLDANLKTQLKAYLEKVTQPFEIVASLDDSDKSRELSELLHDIVGLTDKITLREDGKDAR
VPSFSLNRPGANIGLAFAGIPMGHEFTSLVLALLQVGGHPSKLEAEVIEQVKGIQGKFEF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQEEVERRQIMSVPSIYLNGEVF
GAGRMGVEEILAKIDTGAAAREAEKLSAKDAFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLARALEEHVKQYEVDIMNLQRASALVPAKNAGE
LHEVKFEGGGSLKAKTLILATGARWREMGVPGEQEYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLLEFDSKLRADAVLQRKLYSMPNVEVITSALTSEVKGDG
QKVTGLVYKDRNTDEFKSVELEGIFVQIGLLPNSEWLKGSIELTPRGEIIVDQRGETSLP
GIFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRSSAPA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatctgaagacccagttgaaggcctacctggaaaaggtcacccagccg
ttcgagatcgtcgcgtccctcgatgacagcgacaaatcccgcgagctgagcgaactgctg
cacgacatcgtcggcctgaccgacaagatcaccctgcgcgaagacggcaaagacgcccgc
gtcccgtccttctcgctgaaccgcccgggggcgaacatcggcctggccttcgccggcatc
cccatgggccacgaattcacctccctggtcctggccctgctgcaggtcggcggccacccg
tccaagctcgaggccgaggtcatcgagcaggtgaagggcatccagggcaaattcgaattc
gaaacctacttctcgctgtcctgccagaactgcccggacgtggtccaggcgctgaacctg
atggccgtgctcaacccgaacatccgccacgtcgccatcgacggcgcgctgttccaggaa
gaagtcgagcgccgccagatcatgtcggtgccgagcatctacctgaacggcgaagtcttc
ggcgcgggccgcatgggcgtggaggaaatcctcgccaagatcgacaccggcgccgccgct
cgcgaagctgagaagctgtcggccaaggacgccttcgacgtgctggtggtgggcggtggc
ccggccggcgccgcagcggccatctacgccgcgcgcaaaggcatccgcactggcgttgcc
gccgagcgcttcggcggccaggtgctggacaccatggccatcgagaacttcatctcggtg
caggaaaccgaaggcccgaaactggcccgcgcgctcgaagagcacgtgaagcagtacgag
gtcgacatcatgaacctgcagcgcgccagcgcactggttccggccaagaatgccggcgag
ctgcacgaagtgaagttcgagggcggcggcagcctcaaggccaagaccctgatcctcgcc
accggcgcccgctggcgcgaaatgggcgtgcccggcgagcaggaatacaaggccaagggc
gtgtgcttctgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggtggcggtaactccggcgtcgaagcggccatcgacctggccggcatcgtgtcccacgtg
accctgctggagttcgacagcaagctgcgcgccgacgccgtgctgcagcgcaagctgtac
agcatgcccaacgtcgaggtgatcaccagcgcgctgaccagcgaagtgaaaggcgacggc
cagaaggtcaccggcctggtctacaaggaccgcaacacggatgagttcaagtccgtggag
ctggaaggcatcttcgtgcagatcggcctgctgccgaacagcgaatggctcaagggcagc
atcgagctgactccgcgcggcgaaatcatcgtcgaccagcgcggcgaaacctcgctgccg
ggcatcttcgccgccggcgacgtgaccacggtgccgtacaagcagatcgtgatcgcggtc
ggtgaaggcgcgaaagcctcgctgtcggccttcgaccacctgatccgcagctcggcgccg
gcctga

DBGET integrated database retrieval system