KEGG   Pseudomonas kribbensis: DLD99_15290Help
Entry
DLD99_15290       CDS       T06348                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pke  Pseudomonas kribbensis
Brite
KEGG Orthology (KO) [BR:pke00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DLD99_15290
Enzymes [BR:pke01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DLD99_15290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like DAO FAD_oxidored Thi4 FAD_binding_3 K_oxygenase AlaDh_PNT_C Glutaredoxin NAD_binding_8 FMO-like NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AXI61779
UniProt: A0A345RR63
LinkDB All DBs
Position
complement(3366835..3368397)
Genome map
AA seq 520 aa AA seqDB search
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSREMLDLLKDVASLSHQITLIDSGDDAR
KPSFSINRPGADISLRFAGIPMGHEFTSLVLALLQVGGHPSKASVEVIEQIRSLKGEFNF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQDEVNDRKIMAVPSIYLNGENF
GQGRMGLEEILAKLDTGAIERQAEKISAKESFDVLVVGGGPAGASAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLATALEEHVKQYDVDIMNLQRADKLIPGKNGEL
HEVHFASGATLKAKSVILATGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVSHVTLLEFDVQLRADAVLQRKLHSLPNVTVITSALTTEVTGDGQ
KVNGLRYKDRKTDELRTVELEGIFVQIGLLPNTDWLKGTIELSPRGEIIVDNRGETSIPG
IFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagcccagttgaaatcgtacctggaacgggtcacccagccg
atcgagatcgttgcttctctcgacgacggtgcgaaatcccgtgaaatgctcgacctgctg
aaagacgttgccagtctttcgcaccagattaccttgatcgacagtggcgacgatgcacgc
aagccgtcgttctcgatcaaccgcccgggtgccgatatcagcctgcgtttcgccggcatc
ccgatgggccatgaattcacttcgctggtgctggccctgctgcaagtcggcggccaccct
tcgaaggccagtgtcgaagtgatcgaacagatccgctcgctcaagggcgagttcaacttc
gagacttacttctcgctgtcctgccagaattgcccggacgtggtccaggcgctgaacctg
atggccgtgctgaacccgaacatccgccacgtcgccatcgacggcgcgctgttccaggac
gaagtcaacgatcgcaagatcatggccgtgccgagcatttacctgaacggcgaaaacttc
ggccagggccgcatgggcctggaagaaatcctcgccaaactcgacaccggcgccatcgag
cgtcaggccgagaaaatcagcgccaaagagtctttcgatgtgctggtagtcggcggtggc
ccggccggtgcttcggcggcaatctatgccgcacgtaaaggcattcgcactggcgttgca
gccgagcgcttcggcggtcaggtgctggacaccatggctatcgagaacttcatttccgtg
caggaaaccgaaggcccgaaactggcgaccgcgctggaagagcacgtcaagcagtacgac
gtggacatcatgaatctgcaacgcgccgacaagctgatccctggcaagaacggcgagctg
catgaagtccacttcgccagcggcgcgaccctcaaggccaagagcgtgattctggcgacc
ggcgcacggtggcgtgaaatgaacgtgccgggcgagcaggaatatcgcaacaagggcgtg
gcgtactgcccgcactgcgatggtccgctgttcaaaggcaagcgtgtagcggtgattggc
ggcggtaactccggcgtcgaggcagcgattgatctggccggtatcgtgtcccacgtaacc
ttgcttgagttcgacgtacaactgcgtgctgacgcggtgctgcaacgcaagctgcacagc
ctgccgaacgtcaccgtgatcaccagtgcgttgaccactgaagtcactggcgatggccag
aaggtcaacggcctgcgttacaaggatcgcaagactgacgaactgcgcacggtcgagctg
gaagggatcttcgtgcagatcggtctgttgcccaacaccgattggctcaaaggcaccatc
gagctgtcgccgcgcggcgagatcatcgtcgacaaccggggtgaaacctcgatcccgggc
atctttgctgccggtgacgtgactaccgtgccgtacaagcagatcgtgattgcggtgggc
gagggcgccaaggcttccctcagcgctttcgatcacctgatccgcacttcggccccggcg
taa

DBGET integrated database retrieval system