KEGG   Paramormyrops kingsleyae: 111832773
Entry
111832773         CDS       T05788                                 

Definition
(RefSeq) erythropoietin-like isoform X1
  KO
K05437  erythropoietin
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111832773
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pki04052]
    111832773
Cytokines and growth factors [BR:pki04052]
 Cytokines
  CSF and other factors
   111832773
SSDB
Motif
Pfam: EPO_TPO tRNA_synthFbeta
Other DBs
NCBI-GeneID: 111832773
NCBI-ProteinID: XP_023646225
Ensembl: ENSPKIG00000001109
LinkDB
Position
Unknown
AA seq 184 aa
MEIPRVGLVAVLLMVLEWTHSGLPSPLRPICDPRVLDRFIKEARDMEVTMRSCSDGCSLA
EPLPVPLTSVDFAVWEKEDAQKQAQEVQSGLWLLSEAISVVRASVTSAMLQSLLDNSHSN
LHSIRQVIRSLNFQEYMPPTGGTAHEETWRVSSMPELLRVHTNFLRGKVRLLLASAAACR
RDGS
NT seq 555 nt   +upstreamnt  +downstreamnt
atggagataccccgtgtaggacttgttgctgtgctgttgatggttctggagtggacccat
tcaggtctgccctctccgctgagacccatatgtgacccgcgagtgctggaccgtttcatc
aaggaagctcgggacatggaggtcaccatgcggagctgcagtgatgggtgcagcctagcg
gagcctctgccagtgcccctgaccagtgtcgactttgcagtctgggagaaagaagacgcc
cagaagcaggctcaggaggtacagtcaggcctgtggctgctttctgaggccatcagcgtg
gtccgggcctcagtcaccagcgcgatgctgcagagcttgctggacaacagccatagcaac
ctacacagcatcaggcaggtgatacgcagcctcaactttcaggaatacatgcctccaaca
ggtggcactgcccatgaggaaacctggcgtgtgtcctccatgcccgagctgctccgtgtc
cacacaaacttcctgcgtggcaaagtgcgcctcctgctggcctcagcggcagcctgtcgc
cgagatggcagctga

DBGET integrated database retrieval system