KEGG   Paramormyrops kingsleyae: 111833308
Entry
111833308         CDS       T05788                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04012  ErbB signaling pathway
pki04068  FoxO signaling pathway
pki04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111833308 (cdkn1b)
   04068 FoxO signaling pathway
    111833308 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111833308 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 111833308
NCBI-ProteinID: XP_023647241
Ensembl: ENSPKIG00000021775
LinkDB
Position
Unknown
AA seq 189 aa
MSDVRLSNGSPPLERMEARVSDFPKPSACRVLFGMPNHEELQRELSERLREIEEAKSDKW
NFDFAAHRPLPPGRYKWEPVDDAPEFYGGPRCTPADSRPADAAAENGVDVNGHGGSVQES
AGARPPEHISEGQTDCKERATSQKRKRASADCSSQKKRSRNSSDEVIRNPVVPHSVENTP
RKSSPKTQT
NT seq 570 nt   +upstreamnt  +downstreamnt
atgtcagatgtgcggctctcgaatgggagtccccccctggagaggatggaggcgcgggtg
tcggacttcccgaagccgtcagcctgcagggtgctgttcgggatgccgaaccatgaggag
ctgcagcgggagttaagcgagcgcctgcgggagatcgaggaggccaaaagcgacaagtgg
aatttcgactttgcggctcacaggccgctcccgcccgggaggtacaagtgggagccggtg
gacgacgcccccgagttttacggcggaccgcgctgcacgccagcggactcccggccagcg
gacgctgcagcggagaacggcgtggatgttaatggacacggcggctcggtgcaggagagc
gccggagcccggccgcctgaacacatctcggaagggcaaacggactgcaaggagcgggcg
acgagtcagaagagaaagcgagcgagtgccgattgctcgtcgcaaaaaaaacgatcgcgg
aacagttcggatgaagttattcgtaacccagttgtcccccattcggttgaaaacacaccc
aggaaatccagcccaaagactcaaacgtga

DBGET integrated database retrieval system