KEGG   Paramormyrops kingsleyae: 111833360
Entry
111833360         CDS       T05788                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04010  MAPK signaling pathway
pki04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111833360
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111833360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pki04052]
    111833360
   00536 Glycosaminoglycan binding proteins [BR:pki00536]
    111833360
Cytokines and growth factors [BR:pki04052]
 Growth factors
  Growth factors (RTK binding)
   111833360
Glycosaminoglycan binding proteins [BR:pki00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   111833360
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 111833360
NCBI-ProteinID: XP_023647322
Ensembl: ENSPKIG00000024173
LinkDB
Position
Unknown
AA seq 157 aa
MTEGEITVFPLGPENFGIDMQDYKKLTRLYCLNGGYHLRILPDGTVEGSRDEGDAYNVMR
LKAVSIGVVVIEGREAALYLAMNEQGQLYGTSNLNDDCYFLEKLEENHYNTYMCQKYQDQ
GWYVGIKKNGRPKAGPRTHMGQKAIYFLPRIIDNTSK
NT seq 474 nt   +upstreamnt  +downstreamnt
atgacggaaggggagataacggtgtttccgctgggcccggagaatttcgggatcgacatg
caagattacaagaagctgacgcgcctgtactgcctgaacggcggatatcatctgcggatc
ctgcctgatggcacggtggagggcagcagagacgagggcgacgcttacaatgtgatgcgg
ctgaaagccgtcagcatcggtgtggtggtgatcgagggccgggaggcggcgctatacctg
gccatgaacgagcagggccagctttacggcacatccaacctgaatgacgactgttacttt
ctggagaagctggaggagaatcactacaacacctacatgtgtcagaagtaccaggaccaa
ggctggtatgttggcatcaagaagaacggacggcccaaggctggaccgaggacccacatg
ggacagaaggctatctacttcttacctcgcataatagacaacacaagcaaatga

DBGET integrated database retrieval system