KEGG   Paramormyrops kingsleyae: 111833368
Entry
111833368         CDS       T05788                                 

Definition
(RefSeq) glucocorticoid receptor-like isoform X1
  KO
K05771  glucocorticoid receptor
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111833368
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pki03000]
    111833368
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pki03310]
    111833368
Transcription factors [BR:pki03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    111833368
Nuclear receptors [BR:pki03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   111833368
SSDB
Motif
Pfam: GCR zf-C4
Other DBs
NCBI-GeneID: 111833368
NCBI-ProteinID: XP_023647334
Ensembl: ENSPKIG00000024131
LinkDB
Position
Unknown
AA seq 585 aa
MPGLGVRLAATERHMDQVGLKGSDVQDDGLTLDYSDKEAEGTFPSMPGSGMSVPSAPRKQ
SSSGEVSNGLGGAPPTEEHTSPSLGFYAVGPDSMVLGIDQKAAILHFQNTSMLGLEDNLT
RLEASIADLGRTSTSMDSLIGGTDTDLFLKTEDLSPPDLEQEPFEVVGKDTLKGLGFSSA
SALDILPDFELTGSPCELNDFYVGDEAAFLSTLAVDDSLLADFSTAVKDAKPVGCSNGGG
DDQRAPEASVPPSEIKMEKDACIQLCTPGVIKQEMEPKTYCSLSTSPISICGVSTSGGQG
YQYGVSASASSAVRQLDQKPIFVARPLPSSVETPGGTCQVYGDLAGIPRGSGSFSSGLAF
VPPFISPMARTSTSASVAAGPGKAGGAVHKICLVCSDEASGCHYGVLTCGSCKVFFKRAV
EGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKMNRLKGVQPAAMVE
PPPAAMVEPRTLVPKSMPQLIPTMLSLLKAIEPETIYAGYDSTIPDTSTRLMTTLNRLGG
RQVISAVKWAKALPGEEWAPLTAPLRDGPRSLPRCVMGPAHCPAA
NT seq 1758 nt   +upstreamnt  +downstreamnt
atgccggggctgggagtgcgcctcgccgccaccgaacgacacatggatcaagtgggactg
aaaggcagcgacgtgcaggatgacggcctgactttggattacagtgacaaggaggcagaa
gggacgtttcccagcatgcccggcagcggcatgtctgtgccatccgctcccagaaagcag
tcgagctccggggaggtatccaacgggctgggcggcgcccctcccacagaggagcacacc
tcgccctccctgggcttttatgcagtggggcctgactccatggtgctagggattgaccag
aaggcagccatcctgcacttccagaacacaagcatgttaggcctggaggataacttaact
cgcctggaggcgagcatcgctgacctgggccgcaccagcacctccatggactccctcatc
ggcgggaccgacacggacctcttcttgaaaacggaggatctgtcaccccccgacttggag
caggagccttttgaggtggttgggaaggacaccctgaagggcttgggattctcgtccgcc
agcgccctcgacatcctgccggacttcgaactgacgggctccccctgcgagctgaacgat
ttctacgtgggcgatgaggctgccttcctctcgacgctggcggtggacgactcgctcctg
gccgacttcagcacagcggtgaaggacgcaaagcccgtcggctgcagcaacggcgggggg
gatgaccaacgggcgccggaggccagcgtccccccctcagagattaagatggagaaggat
gcctgcatccagctgtgcacccccggcgtgattaagcaggagatggagcccaagacctac
tgtagcctgagcacctcgccgatctccatctgtggcgtgagcacctccggtggccagggc
taccagtacggcgtcagcgcctctgcttcgtcggcggtccgccagcttgaccagaagccc
atcttcgtggctcggcctctgccctcctccgtggaaacgccgggtggcacctgccaggtg
tacggggacctggctgggatccccaggggcagcgggtccttctccagcggccttgctttt
gttcctcccttcatcagtcccatggccagaaccagcaccagcgcatctgtggctgcgggt
cccgggaaggctggcggagcggtccacaagatctgcctggtgtgctcagacgaggcatcc
ggctgccattacggggtgctgacctgcgggagctgcaaggtcttcttcaagagggctgtg
gaagggcagcataattacctgtgcgccgggaggaacgactgcatcatcgacaagatccgg
aggaagaactgcccagcttgccgttatcggaaatgtctgcaggccggcatgaacctggaa
gcaagaaaaactaagaagatgaacagactgaagggggtgcagccggcggccatggtggag
cccccccctgcggccatggtggagcctcgcaccctggtgccgaagtccatgcctcagctc
atccccaccatgttgtcactgctgaaggccatcgagccggagaccatctacgcgggttac
gacagcaccatccccgacacctccacccgcctcatgaccacgctgaacaggctgggcggc
cgccaggtcatctccgccgttaagtgggccaaggccctgccaggtgaggagtgggccccg
ctcactgccccgctgcgtgatgggccccgttcactgccccgctgcgtgatgggccccgcg
cactgccccgctgcgtga

DBGET integrated database retrieval system