KEGG   Paramormyrops kingsleyae: 111833981Help
Entry
111833981         CDS       T05788                                 

Gene name
alk
Definition
(RefSeq) ALK tyrosine kinase receptor
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
pki  Paramormyrops kingsleyae
Brite
KEGG Orthology (KO) [BR:pki00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pki01001]
    111833981 (alk)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pki04090]
    111833981 (alk)
Enzymes [BR:pki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111833981 (alk)
Protein kinases [BR:pki01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   111833981 (alk)
CD molecules [BR:pki04090]
 Proteins
  111833981 (alk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase MAM Gly_rich Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 111833981
NCBI-ProteinID: XP_023648574
Ensembl: ENSPKIG00000022905
LinkDB All DBs
Position
Unknown
AA seq 1414 aa AA seqDB search
MSTGAFCLFVLSAAFLAGLQCASQKSSMGIGVTLPSTALAGSGEASGKKDANQTHTSRRK
RKNLSVDFAVPSLLRNYLSEFIKRPLNGDCQHADGCYAVRANLRMQCVPLQKTVSSLLET
KLSAADSPDNVSAAGQLPYRNKRPLSRVLNFALTKDSRKSNQVVIEIGEESVRTGCGGLS
VDGDPPQATLEIDLTRILEWWLGAGGGRLRVRLIPERRAQVPGREEKYSAAIRAADPRLF
LQIASRGTPQAAHGTGVPRGYWNFTWTAEDELSFPEETAEAESRCHGNGRQACGWPPGDG
PDFSWSVLPAGDLWESERTGRVRRTWDEGQFLSVNGSVLGGPWVTSPWLRGGRWRCSLDM
SIFLHPQQSGRYTVWLIERDKKPSVLLTTDTPRSPGWVILRLTVGARMDPFRISSGYSQP
SDAGTAAFDPDFTTNCTLASSPTPNITLQGWYRCHQGPLIAMGRMCDFRMDCPHGDDEGH
MCSHFISGSYCSFEAGDCGWQSVSPRGPSWKLQASEPGAPATSCQPRGTVMAARGGQSKG
QQGAALLRSPLFPPPLRNSLCVVRFWMCSGGLHRGALSVWVVENGTGPDIRRSLWDSAAE
AHAGPGGRLVVIPLYGLADWFWLQFSAEELSGPGSVLCLDNISLSLDCFLASNGEFPPVV
PMVNITIPEPTNRTMRVTPSATGDLPSTTLIPPPSDAKWTFHTCGATGPVGPTPTQCSNS
YRNTNINITVGTKGMLKGMQMWKVPETGTYRITGYGAAGGRSVVTTARSHGVYVTADFHL
QQDQLLYILVGQQGEDACPNSNHTLNRVCLEQTLPIDSKTRAKLPGGGGGGGGGGATYIF
KMKKGVPVPLLIAAGGGGRGYSSQSESQEELLDIDPSVFGLNGRSGAAGGGGGWNDSMPV
ATQGGRPLLLGGQGGTSCRFGWQTRGGFGGGGGACSSGGGGGGYRGGGTAQDDNPSHDGK
DGSSFVSPIGETFIEPLKGIEGHGEVVISPVLNCSHCETGDCHESGDDVVCFCEEDLELA
ADGVSCVNTTDNSVLHPQLALGLSVGTSALIAALLLAVSGVMIMYRRKHTELQSIQLELQ
SPDCKLSKLRASTIMTDYNPNYCFAGKTASVNDLKEIPRRNISLTRGLGHGAFGEVYEGL
AVGIPGEPSPMQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVCCIGVSLQALPRFI
LLELMAGGDLKSFLRETRPRVDQPSSLNMVDLLNVARDIARGCQYLEENQFIHRDIAARN
CLLTCKGPGRVAKIGDFGMARDIYRASYYRKGGRAMLPVKWMPPEAFMEGIFTSKTDTWS
FGVLLWEIFSLGYMPYPSRSNQEVLEFVTNGGRMDPPKNCPGPVYRIMTQSWQHQPEDRP
NFSTILERIDYCLQVGQPSLSHARDYLWPPDLSD
NT seq 4245 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccggggcgttttgcctgtttgttttatccgcggcgtttctcgccgggctgcag
tgcgcatcgcagaagagctcgatggggatcggggtaaccctacccagcacggcgctggca
ggcagcggggaggccagcgggaaaaaagacgccaaccagacgcacacctccagacgcaag
aggaagaacctgtccgtggatttcgccgttccctctctcttaagaaactacctgtctgaa
ttcataaagcgcccgctgaacggcgactgtcagcatgcagacggatgctacgcggtgcgg
gcaaacttaaggatgcagtgcgtccccctgcaaaagacagtctccagtttgttggagacc
aagctgagcgccgccgactcccccgacaatgtttcagccgccggacagctcccgtacagg
aacaagcggccgctgtccagggtcctgaatttcgcgctgaccaaggacagtaggaaatcc
aatcaggtggttatagagatcggggaagagagcgtccgcacgggctgcgggggtctctct
gtggacggggaccccccacaggctacactggaaatagacctcacccgcattttggagtgg
tggctgggagccggagggggacgactcagggttaggctcatacccgagaggcgagcacaa
gtcccgggaagagaggagaagtactcggccgcgatccgagcggctgatccccgcctcttc
ctccagatcgcttcccgtggtacgccgcaggccgcccacggcaccggcgtcccccgaggc
tactggaacttcacctggacagcagaggatgagctcagcttcccagaggagacggcagaa
gccgagtcccgctgccatggcaacggcaggcaggcttgcggatggcccccgggagacgga
ccggacttcagctggagcgtgctgccggccggggacctgtgggagtcagaacggacgggt
cgcgtgcggcgcacctgggatgaagggcagttcctgtctgtgaatggctctgtcctgggg
gggccctgggtgaccagtccttggctgcgggggggccgctggcgctgcagcttggacatg
tccatcttcctccacccccagcagagtggacgctacacggtgtggctaattgagcgagac
aagaagcccagcgtcctgctcaccacggacacgccgcgcagcccgggctgggtgattctg
cggctcactgtgggagctcgcatggaccccttccggatctcgtccggctacagccaaccg
agcgatgcaggaactgcggccttcgatcccgacttcaccaccaactgcaccctggcctcg
tctcccacgcccaacatcaccctccagggttggtaccgctgtcaccagggacctctgatc
gccatgggacgcatgtgcgatttccggatggactgtccccatggcgacgacgaaggacac
atgtgcagtcattttatcagcggcagctactgctcgtttgaggccggcgactgtggatgg
cagtccgtctccccgcggggcccatcctggaagctccaggcctccgagccaggagccccc
gccacgagctgtcagccccgagggacggtcatggctgcaagaggcggtcagtctaaaggc
cagcagggggcagcgttgctcaggagccctctttttccgccacctctcaggaactcccta
tgcgtggtccgtttctggatgtgttccggaggcctccacaggggggcgctgtctgtttgg
gtggtagagaatggcacagggcccgacatacggcggagcctttgggactcggctgccgag
gcccatgcaggaccaggcgggaggctggtcgtcatcccgctgtacgggctagcggactgg
ttctggctgcagttcagcgccgaggaactctcaggtcctgggtcggtcctctgcctggac
aacatctccctcagtctggactgcttcctggcctccaatggagagtttcctccagttgtt
cccatggtgaacatcaccatacccgaaccgacaaaccggactatgagggtcacgccttca
gccactggggatctgccttcaacgactcttataccgcccccaagtgacgccaagtggacc
ttccacacctgtggagccactgggcctgtaggtcccacccccactcagtgtagcaattcc
tatcggaacaccaacatcaacatcaccgtgggaaccaaggggatgctgaagggcatgcag
atgtggaaggttccagagacgggaacctacaggatcacgggctacggggccgcgggtggc
cgcagtgtggtgaccacagccaggtcgcacggggtctacgtcaccgcagacttccatctg
cagcaggaccagctgctctacatcctggtgggacagcagggggaggacgcctgtccgaac
tccaaccacacgctcaacagggtgtgtttagagcagacattgcccatcgatagcaagacc
agagcaaaactgccaggaggtggaggcggaggaggtggaggcggagccacgtacattttt
aagatgaaaaaaggggttccagtgcccctgctcatagcggctggcggtggggggcgtggc
tacagcagccaatcagagagccaggaggagctgctggacatagaccccagtgtattcggg
ctcaatggacgctcaggagccgcaggtggcggtgggggctggaatgacagtatgccagtg
gcgacacagggtggtaggcctctcctgttggggggccaggggggcacgtcctgtcggttt
ggctggcagacacgagggggcttcggaggagggggtggagcctgctcctctggtggagga
ggagggggctacagaggaggcggcaccgctcaggacgacaacccgagccacgacgggaag
gatggctcatcttttgtcagtcccatcggagagaccttcatcgagcctctgaaagggatc
gagggtcacggggaggtcgttatctcgcccgtgctgaactgtagccactgcgagaccggc
gattgccatgagagcggcgatgatgtcgtgtgcttctgcgaggaggaccttgagctggcc
gctgacggggtgtcctgtgtcaacaccacagataattcagtgctgcacccccagctggcc
ctggggctctcggtgggcacctctgccctcatcgctgccctgcttctggctgtatcaggc
gtcatgatcatgtacagacgcaagcatacagagctgcagtccatccagctggagctgcag
agtcccgactgcaaactcagcaagctgagggcctccaccatcatgaccgactacaacccc
aactactgtttcgctggcaagacggcatccgtcaacgacctgaaggagattccacgccgc
aacatctcgctcaccaggggtttgggccacggtgcgtttggagaggtgtatgagggtctt
gcagtagggatacctggagagccaagcccaatgcaggtggccgtaaagacccttcctgag
gtttgctctgagcaggacgagttagacttcctcatggaggctctgatcatcagtaagttc
aaccaccagaacatcgtgtgctgcattggcgtcagtctgcaagccctgccgcgtttcatt
ctgctggagctcatggcaggaggagacctaaagagcttcctcagagagacccgaccaaga
gtggaccagccctccagcctgaacatggtggacctgctgaacgtggcccgagacatagct
cggggctgccagtacttggaggagaaccagttcatccacagggatatagcggcccgtaac
tgcctgctgacgtgcaaagggccgggaagagtggccaagatcggagactttgggatggcc
agagatatatacagggcgagttactacaggaagggtggcagggcgatgctgcccgtcaag
tggatgccccctgaagccttcatggagggaattttcacctccaagacggacacctggtcc
ttcggcgtgctgctctgggagatcttctccctgggctacatgccgtaccccagtcgcagc
aaccaggaggtgctggaattcgtcaccaatgggggcaggatggacccccctaagaactgc
cccgggcccgtttacagaataatgacacagagctggcagcatcaaccagaggacagaccg
aacttctccaccatcctggagaggatcgactattgcttacaggtcggccagccgtcactc
tcgcatgccagagattacctatggccgcctgacttaagtgactga

DBGET integrated database retrieval system