KEGG   Paramormyrops kingsleyae: 111834003Help
Entry
111834003         CDS       T05788                                 

Definition
(RefSeq) zinc finger CCHC domain-containing protein 2-like isoform X1
  KO
K22700  Zinc finger CCHC domain-containing protein 2
Organism
pki  Paramormyrops kingsleyae
Brite
KEGG Orthology (KO) [BR:pki00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    111834003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CCHC zf-CCHC_3
Motif
Other DBs
NCBI-GeneID: 111834003
NCBI-ProteinID: XP_023648615
Ensembl: ENSPKIG00000001849
LinkDB All DBs
Position
Unknown
AA seq 1046 aa AA seqDB search
MLKMKLPGRTAEEGAGNAAENVQDVTGGGLHIPGSAPHTPSNRSEDAARRLACPLLQLDK
EAVFEWFGLHLSPARRIEFMCGLLHMCQPLELRFLGSCLEDLARKDFHVLRDFEIRANSL
GELGLLADIGDPVVRSKLLVSLSLLGSENRECAGILFRILSHVDAALSCKSYGLTVPSCR
DSQHSHIRPSCDDGSGADSGRAEPCCGPKPEAGYGAPEQLALLFTMASLHPAFPFHQRET
IRVQLDKVEKVMEEERRDRQQGANARNKLPKRDYLSSGTETRMTSRAQSPRPGQPPARSY
QKEAVYIEKIVLRGVSRGRTEREYSFVLKWSDSTSSNVTKTHLELENFLLKLPKEQAVDS
FEKAILRLLSQGDALEGRELEGTLRERFLSTPPAFRKSAKVCSFFLTDSSSPGCSHCTAP
SLGKPATAGEHFVEDGSEASSQEEGAHMESFILGYRKKPGSKSPGLGLQGVRSPQTDSRR
PPHPELNGVTDWMRKNPVQKSGPDPCGAGPQKHPGDEKRAGPPANKSKVRASAADREKLK
KPEAKAASASNGVGRLGPPQLTRQPGGKGLGPDAYGETSSESYSSPSSPQHDGRESLESE
DEKDRETDSNSDDSSKGRADSILLGKPVGGAVVATVRPMPPGAQRDGPPAPPELPPMAFM
QPVAFVVPNGTSRTEKPAGGVMLPLPAAFREPLPTGPLGDVEKLPPAPPSQLGLLPPISP
VNQPLVQRFKTAPIPSPAPGPPISDGGASATVHQPPMGAISVIPPSPAYVSPLQAAFPST
EPSLPEPHHKAPGMSLPSALPSPYSLATPTLTGPPASFGTSTPGQSQAAAVPTHVPGPAP
TPSPALTHSTAQSDGTSFINGPAPQQPQPGPPQPAGCGACGCRGSCGNMHPPSYCYAPQM
AQQAFSMQPFLHLTSLCGGGGGAYLSQGAGSSGATQLPFFPAAPSPYGSRLPLYTSSEPV
LGAQAGYGLQHLAAFGRIYQPLFPSVGLLPGLKKGTGASCYNCGVSGHYAQDCKQPSIDA
AQQGNVTTVRGRDWRGPLLTLPFPPK
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaatgaagctgcccgggagaacggcggaggaaggagcggggaacgcggccgag
aacgtgcaggatgtgaccggcggtggtctgcacatccccgggtccgctccgcacacgcct
tccaacaggtcggaggacgccgcacgaaggctggcatgccccttgctccagctggataag
gaggcggtcttcgagtggttcggcttgcacctgagtccagccaggcggatcgagttcatg
tgcggtctgctgcacatgtgccagccgctggaactccgattcttgggctcttgtctggag
gacctggcgcggaaggactttcacgtcctccgggacttcgagatcagggcgaacagcctg
ggcgagctgggcctcctggcggacatcggcgacccggtggtgcgctccaagctgctggtc
tccctctccctcttgggatctgagaaccgggagtgcgccgggatactctttcgcattttg
agccatgtggatgcggcgctgagctgcaaaagctacggcctcaccgtgccgtcctgccgg
gactcccagcattcccacattcgtccttcgtgcgacgacggcagcggcgccgactcgggc
agagcggagccctgctgcgggcctaagccggaggcggggtacggtgctccggagcagctg
gcgctgctttttaccatggcctccctgcacccggcgttcccgtttcaccagagggagact
atcagggttcagctggataaagtggagaaagtgatggaagaggagcggagagaccgccag
cagggtgccaacgctcggaataagcttccaaaacgggattacctctcctccggcactgag
accagaatgaccagtagagctcagtcacccagacctggccagcctccggcaaggagctac
caaaaagaagccgtgtacatcgagaagatcgtgctgaggggggtgtcacgcggcaggacc
gagagggagtacagctttgtgttgaagtggtctgactccacatcaagcaacgtaacgaaa
actcatcttgaactggagaacttcttgttaaagcttccaaaggagcaggctgtggactcc
tttgagaaggccatcttgaggttactcagccagggggacgcgctggagggcagggagctg
gaggggacactgagggagaggttcctgtccacgccgcctgcttttcggaagtctgccaag
gtctgtagcttctttctgacggactcgtccagtccaggctgcagccactgtacagcgccc
tccctggggaagcctgctacagcaggcgagcacttcgtggaggacggttccgaggcctcg
agccaggaggaaggtgcgcacatggagtctttcattcttgggtaccgcaagaagcctgga
agcaagagcccgggcctgggcctccagggtgtaaggagcccacagactgacagtcggagg
cccccccacccagagctgaatggagtgacagactggatgaggaagaatcctgtgcagaag
tctggcccggatccctgtggggcgggaccacagaagcaccccggcgatgagaaacgagcc
gggccaccagccaacaagagcaaagtgagagcttcggcagcagaccgggagaagctgaag
aagccagaggccaaggcggcctctgcctctaatggggtgggcagactgggccctccgcag
ctcacgcggcagccgggcggaaaagggctgggcccagatgcctatggggagacgtcctcg
gagagctacagctccccctccagtccgcagcatgatgggcgggagagcctggagagcgag
gacgagaaggacagagaaacggacagtaactccgacgactccagtaaaggcagagcagac
agcatcctgctcggcaagcctgtagggggcgccgtcgtggccaccgtgcgacccatgccg
cccggagcgcagcgggatgggcccccggctcctcccgagctccccccgatggccttcatg
cagcctgtggcatttgtggtgccgaacggcaccagcaggacagagaagccagccgggggt
gtgatgctgccgctgcccgccgccttccgcgagcccctccccacggggcccctaggggac
gtcgagaagcttccgccggcacccccctcgcagctgggcctgctgccccccatcagcccg
gtcaaccagcccctggttcagcgcttcaagactgcccccatccccagccccgctcctggc
cctcccatctctgatggcggggcctccgccacagtgcaccagccaccaatgggcgccatc
agcgtgatcccgcccagccccgcctacgtgtcccccctgcaggcagccttccccagcacc
gagccttccctgccggagccccatcacaaagccccagggatgtctctgccgtccgccctg
ccctcgccctacagcctcgccacccccacgctgaccgggccccccgcttccttcggcacc
tccacgccaggccagtcgcaggccgccgcggtgcccacgcatgttcctggccccgccccc
acgccgagccccgccctgacgcacagcaccgcccagagtgacggcacctccttcatcaac
ggccccgcccctcagcagccgcagcccggccctcctcagccagcgggctgcggtgcctgc
ggctgccgcggcagctgcggaaacatgcacccgcccagctactgctatgcaccccagatg
gcgcagcaggcattcagcatgcagcccttcctgcacctgacgtcgctctgcggcggtggg
ggcggtgcctacctcagccagggggccgggagctccggcgccacccagctgcccttcttc
ccagcggcgccctcgccctacggcagcaggctgccactgtacacatcctccgagcccgtg
ctgggggcccaggccggctacggcctgcagcacctggccgccttcggccgcatttaccag
ccgctcttcccgtcggtgggattgctgcccggcctgaagaagggcaccggcgcgtcctgc
tacaactgtggggtcagtgggcactatgcacaggattgcaaacagccctccattgacgca
gcgcagcaaggtaatgttaccacagtcagggggagggactggagaggacccctactaacc
ctgccgttcccccccaagtga

DBGET integrated database retrieval system