KEGG   Paramormyrops kingsleyae: 111834545Help
Entry
111834545         CDS       T05788                                 

Gene name
slc25a26
Definition
(RefSeq) S-adenosylmethionine mitochondrial carrier protein isoform X1
  KO
K15111  solute carrier family 25 (mitochondrial S-adenosylmethionine transporter), member 26
Organism
pki  Paramormyrops kingsleyae
Brite
KEGG Orthology (KO) [BR:pki00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pki02000]
    111834545 (slc25a26)
Transporters [BR:pki02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   111834545 (slc25a26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 111834545
NCBI-ProteinID: XP_023649727
Ensembl: ENSPKIG00000022646
LinkDB All DBs
Position
Unknown
AA seq 284 aa AA seqDB search
MDNARLNANQSVIPVNTMERREFTASLVAGGIAGMCVDLTLFPLDTIKTRLQSPQGFARA
GGLRGIYAGVPSAAVGSFPNASAFFVTYEATKSLLGACGPPHAAAATHMLAASLGEIVAC
LIRVPTEVVKQRAQAGPSSGTLQVLLRTLRQEGFWGLYRGYGSTVLREIPFSLVQFPLWE
YLKSLWSRRQGHTLYSWQAAVCGAFAGGVAAFVTTPLDVAKTRIMLAKAGTSTASGNIPR
VLYEVWKRQGLLGLFAGSLPRMAFISIGGFIFLGAYDKVRSMLL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggataatgcgaggctgaatgcgaatcaaagtgtaattcccgttaataccatggaaaga
agagaatttactgcttcgctcgtggctgggggcatcgcgggcatgtgcgtagacctcacc
ctcttcccgctggacaccatcaagacccggcttcagagcccgcagggctttgccagggcg
ggaggtttgcgtggcatctacgccggggtgccctcagccgcggttggatctttccccaac
gcctctgcgttcttcgtcacctacgaagccaccaaatccctgcttggggcatgtgggccc
ccacatgcagcggccgccacacacatgctagctgcatccttgggagaaatcgtggcctgc
ttgatccgcgtgcccacagaggtggtgaagcagcgagcacaggcaggcccgtcctccggc
acgctgcaggtgctgctgcggactctacgccaggagggcttctggggcttgtaccgaggc
tacgggagcaccgtgctcagagagatccccttctccctggtgcagtttcctctctgggag
tacctcaagagcctttggtcacggaggcagggtcacacgctgtattcttggcaagctgca
gtatgtggagcgtttgcagggggggtggctgcgttcgtcacgacgccactcgacgtagcg
aagaccagaataatgctggccaaggccgggacgagcacagcgagtggaaacatcccccgg
gtcctgtacgaggtctggaagagacaggggctccttggcctgtttgctggcagcctcccc
cggatggccttcatcagcatcggggggttcatattcctgggggcatacgataaagtccgc
agcatgctgctttag

DBGET integrated database retrieval system