KEGG   Paramormyrops kingsleyae: 111835167Help
Entry
111835167         CDS       T05788                                 

Gene name
dpm1
Definition
(RefSeq) dolichol-phosphate mannosyltransferase subunit 1 isoform X1
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00510  N-Glycan biosynthesis
pki01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    111835167 (dpm1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pki01003]
    111835167 (dpm1)
Enzymes [BR:pki01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     111835167 (dpm1)
Glycosyltransferases [BR:pki01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   111835167 (dpm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_transf_21 Glyco_tranf_2_4
Motif
Other DBs
NCBI-GeneID: 111835167
NCBI-ProteinID: XP_023650937
Ensembl: ENSPKIG00000023975
LinkDB All DBs
Position
Unknown
AA seq 253 aa AA seqDB search
MQYNMANRKTSKSRVSSDKYSVLLPTYNERENLPLIVWLLVKYFGESGYDYEIIVIDDRS
PDGTLEVAEQLQNIYGADKIILRPREKKLGLGTAYIHGIKHATGNFVIIMDADLSHHPKF
IPEFIQKQREGGFDLVSGTRYSGDGGVYGWDLRRKLISRGANFLTQVLLRPGASDLTGSF
RLYKKEVLGQLVKKCVSKGYVFQMEMIVRARQLGYSIGEVPITFVDRVYGESKLGGNEIV
SFLKGLLTLFATT
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacaacatggcaaataggaaaaccagcaaaagccgagtaagcagtgataaatat
tccgtgttgttaccgacgtataatgagagagaaaatttgcccttgatagtgtggctgttg
gtgaagtactttggagaaagtggctatgactacgagatcatcgttatcgatgacaggagc
ccagatgggacgctggaagtggcagagcagctgcagaacatttatggtgcagataagatc
attcttcgtccgagggaaaagaaactggggttgggaactgcttacatccatggtatcaaa
catgccactggaaactttgtaatcatcatggatgctgacctctctcaccatcccaagttc
attcctgaatttattcagaagcaaagggaaggagggtttgacctggtgtccggcactcga
tacagtggcgatggaggagtgtatggctgggacctgcgcagaaaactcattagccgagga
gccaactttctcactcaagtcctgctgaggccgggagcgtcggacctgactggcagtttc
aggttgtataaaaaagaggttcttgggcagcttgtgaagaagtgtgtttccaagggctac
gtttttcagatggagatgattgtcagggcccgacaactagggtacagcattggagaagtt
ccaatcacatttgtggaccgtgtttatggagagtccaaactgggtggaaatgaaatagtc
tcctttctgaaagggttgttaactctttttgctaccacttga

DBGET integrated database retrieval system