KEGG   Paramormyrops kingsleyae: 111835194
Entry
111835194         CDS       T05788                                 

Gene name
kitlg
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04010  MAPK signaling pathway
pki04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111835194 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111835194 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pki04052]
    111835194 (kitlg)
Cytokines and growth factors [BR:pki04052]
 Growth factors
  Growth factors (RTK binding)
   111835194 (kitlg)
SSDB
Motif
Pfam: SCF SF-assemblin
Other DBs
NCBI-GeneID: 111835194
NCBI-ProteinID: XP_023650982
Ensembl: ENSPKIG00000024265
LinkDB
Position
Unknown
AA seq 263 aa
MKKAKIWISVCIHFISFITFVTSVSEIRSPLTDDVDKISILKQNIPKDYWITLHHIPKEV
SGMCWVDLNVYHLEESLKQLAQKFGNISSNRDNIAIYIQTLQDIRYNIVKKIDLGFIMEE
FQCHYREVRWQTANYFDYVKDFLSAARSRRGDAECDSPPCPPTTQAIVTERLSRPPEADG
CDGLVPGCGPRTEHQYLPRISDKGLLLLLIVPLAVGLLCLAWKMCRRQRLAPDTDAEHGA
QVKDPTADTDTSEEKITLNVDTV
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaagaaggcaaaaatttggataagtgtctgcatccattttatatccttcatcacattt
gtaaccagtgtgagtgaaatccgaagccccttaaccgatgatgtggacaaaatctccata
ctgaaacaaaatatacccaaagattactggattacattacatcacattcctaaagaagtg
agtggcatgtgctgggttgatctcaatgtttatcatttggaagaaagtttgaaacaactg
gcacaaaagtttggaaacatttcttctaacagagataacattgctatatacattcaaact
ctacaagatatacgctacaacattgttaaaaaaattgatctgggcttcataatggaagaa
tttcagtgccattatagagaagttagatggcaaacagcaaattattttgactatgttaaa
gattttctgagcgctgcgcgctctagaagaggagacgctgaatgtgactctcctccctgt
cctccgacaactcaggccatcgtaacagagcgtctctccaggcccccagaagcagatggg
tgtgacggactggtgccgggttgtggcccaagaacagagcatcagtacctgccacgaata
tcagataaaggccttctgttactgctgattgttcccctggctgtaggtctgctctgccta
gcatggaagatgtgcagaaggcaaagactcgcacccgacacagatgctgaacatggagca
caagtcaaagaccccactgcagatactgacacgtctgaggaaaaaataacactgaatgtt
gacacagtgtag

DBGET integrated database retrieval system