KEGG   Paramormyrops kingsleyae: 111835411
Entry
111835411         CDS       T05788                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2-like isoform X1
  KO
K04291  lysophosphatidic acid receptor 2
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04080  Neuroactive ligand-receptor interaction
pki04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111835411
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111835411
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pki04030]
    111835411
G protein-coupled receptors [BR:pki04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    111835411
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 UPF0093
Other DBs
NCBI-GeneID: 111835411
NCBI-ProteinID: XP_023651460
Ensembl: ENSPKIG00000010178
LinkDB
Position
Unknown
AA seq 369 aa
MDIHGKSNCYYNQTVEFFYSQTGKNISSNWGTRDKVVVGLGLTVSVIVILANILVMTAII
INHRFHYPIYYLLGNLAAADLFAGLAYLHLMFHTGPWTRRLTVYSWFLRQGLIDTSLTAS
VVNLLAVAVERHQSVFTMQLHSNMSKRRVLSLILGIWLVAGLLGLVPSMGWHCLCHLSDC
SKMAPLYRRSYLVFWAVLNLLTFFIMLAVYTRIFVYVRHKSQCMSQHTMQVKHQETVVNL
MKTVSMILGAFVICWTPGLVLLLLDGLHCEACQVLRYEKYCLVLAECNSLMNPIIYSYRD
QDMRQTFRQILCCWYWRRQRSRRHQEATLGIRFNTQEEEVLSVKLVRNKHTSSMNNGTNS
SEMLSFSEG
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggacattcatggaaagtcaaactgctactacaaccaaacagtggagttcttttacagc
cagactgggaagaacatcagctcaaattggggcacacgtgacaaggtcgtggtggggctg
ggcctcaccgtttctgttatcgtcatcttggccaacatcctggttatgactgccatcata
attaaccatcggttccactatccaatctactacctcctgggcaacctggctgcagcagac
cttttcgctggcttggcttacctgcacctgatgttccacacgggtccctggaccaggcgg
ctcacggtatacagctggttcttgcggcagggtctgattgacaccagcttgaccgcatcc
gtggtgaacctgttggctgtagcggtggagcgccatcagtcagtgttcaccatgcagctt
cacagcaacatgagcaagaggcgggtgctatccctcatactgggaatctggctggtggcg
gggcttttagggctggtgcccagcatgggttggcactgcttatgccacctgtctgactgt
tccaagatggcgccgctgtatagacgcagctacctggtcttctgggctgtgctcaacctg
ctcacattcttcatcatgttggccgtctacacgcgcatctttgtgtacgtgcgccacaaa
agccagtgcatgtcacagcacacgatgcaggtcaagcaccaggaaacagtggttaacctt
atgaagactgtctccatgatcctgggtgcatttgtgatctgctggacccctggcctggta
ctcctgctactggatgggctccactgtgaggcttgtcaggtactgagatatgagaagtat
tgcctggttctggccgaatgcaattcgctgatgaaccccatcatctactcataccgggac
caagacatgcggcaaaccttcagacaaattctgtgctgctggtactggcggagacagcgc
agccggcgccaccaggaggcgacactgggcatccgcttcaacacccaggaggaggaggta
ctctccgtgaagcttgtcagaaacaagcacacaagctccatgaacaatggcaccaacagc
agtgagatgctctccttctcagagggctga

DBGET integrated database retrieval system