KEGG   Paramormyrops kingsleyae: 111837508
Entry
111837508         CDS       T05788                                 

Gene name
ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04010  MAPK signaling pathway
pki04210  Apoptosis
pki04620  Toll-like receptor signaling pathway
pki04621  NOD-like receptor signaling pathway
pki04622  RIG-I-like receptor signaling pathway
pki04623  Cytosolic DNA-sensing pathway
pki04625  C-type lectin receptor signaling pathway
pki04920  Adipocytokine signaling pathway
pki05132  Salmonella infection
pki05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111837508 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111837508 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111837508 (ikbkg)
   04621 NOD-like receptor signaling pathway
    111837508 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    111837508 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    111837508 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    111837508 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111837508 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111837508 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111837508 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pki01001]
    111837508 (ikbkg)
Protein kinases [BR:pki01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   111837508 (ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 GAS Tox-URI2
Other DBs
NCBI-GeneID: 111837508
NCBI-ProteinID: XP_023655410
Ensembl: ENSPKIG00000024299
LinkDB
Position
Unknown
AA seq 677 aa
MKLGPLRLDFISQRQQHFGWTTKHEMSEEVGRGIPPVAGRIVRTRSNFMQSKAKPPVLGW
DNRRTRTRRRPNWRSRTTRAQAPTYDHRWLWIMVQPQAQTGSTLQWEMAGGDGVGSGGQG
SLRVPPELAENEVVSRLFTDNHQLREALRRSNVALRERCEDMEKWQQLSRKEKEFLTCRF
QEAKALVERLSQEKQDLWSQLNQTDPRAQAGSPILPQTNNLNCLEKLEDREGKEEDRTSQ
QTPPESVAYSSVCSSVSTVFPSLAESLTPPEGEAWGEGEGGAGSKPADGSNQFLKLLKSH
KEKLEENLRELRDQKKELEVQKEKVELERDRLLSTNEQLQQKLMQMQGGSVTEETVQQSP
ACAEDSDTSQVAKLMEELQITQSRCSELQEKYDSLQKTTAQLDKTEARLKQRDKEFEQIT
KDSEALKAQVTSLLGELHERQSCLDKSEVEGRLLQERLTAKTEALQIKERDMETMKKQHS
VTVDQLRLQNENKETALKTERMLVTEEKRKLAQLQQAYTQLFTDYDTKLRNGGEVEDKLR
EAEMALVMKQDLIDKLKEELEQQRMSLETVPVLAAQAEIFKADFLAEREARETLNQRKEE
LQEQLNKAVAEIDLLKVGVTSRARMEEMQQRHMGEYRALPTSGGMVSEELPDYRCPKCQY
QAPDIDTLQIHVMDCIQ
NT seq 2034 nt   +upstreamnt  +downstreamnt
atgaagttagggccgcttcggctggacttcatttcccagcggcagcagcacttcggctgg
acgacgaaacacgaaatgagtgaggaagtaggaaggggaattcctccagtagcaggacga
atcgtcagaacgcgcagcaacttcatgcagtccaaagcaaagcctcccgttttgggctgg
gataaccggcggaccaggactcggcgccgaccgaactggcggagccggacaacccgagcg
caggcgccgacctacgatcatcgctggctttggattatggttcagccccaggctcagacg
ggcagtaccttgcagtgggagatggcagggggagatggcgtgggctccggcgggcagggg
tcgctccgggtgccgcccgagctggcggagaacgaggttgtcagcaggcttttcacggac
aatcaccaactcagagaagccttgagaaggagtaatgtggctctcagggagagatgcgaa
gatatggagaaatggcagcagctatccaggaaggagaaggagttcctcacctgccggttc
caggaggccaaggcgctggtggaaaggctgtcccaggaaaagcaggacttatggagccag
cttaaccagacggaccctcgtgcccaggcaggaagccccattctgccgcagacaaacaat
ctcaattgtcttgagaaattggaggacagggagggaaaagaagaggataggaccagtcag
cagacacccccagagagtgtggcctactccagtgtctgtagctccgtcagcacagtcttc
ccaagcctagcggagagtctgactcctccggaaggggaggcctggggagagggagagggt
ggggcagggagcaagcccgcagatggctccaatcagtttctgaagctgctgaagagccac
aaagagaagctggaggagaacctgcgggagctgcgggaccagaagaaggagctggaggtg
cagaaggagaaggttgagttggaacgggaccggctgctgagcaccaatgagcagctgcag
cagaaactgatgcaaatgcaggggggcagcgtcactgaggagaccgtacagcagtcaccc
gcatgcgctgaggactctgacacgtctcaggtggccaagctcatggaggagttacagatt
acacagtcccgatgcagtgagcttcaagagaagtacgactctctccaaaagaccacagcc
cagctggacaaaacggaagctcggctgaagcagagggacaaggaatttgagcagataacc
aaagacagcgaggctctgaaggcccaggtgacctcgctgctgggggagcttcatgagcga
cagagctgcctggacaagagcgaagtggagggccggctgctgcaggagaggctcactgcc
aaaacggaggccctgcagatcaaggagagggacatggagaccatgaagaagcagcacagt
gtcaccgtggaccagctgcgtctgcagaatgagaacaaggagacggcgctcaagacagag
aggatgttagtgacggaggagaagaggaagttggcccagctacagcaagcctatacacag
ctgttcacagactatgacactaaacttcggaacgggggcgaggtggaggacaagttacgg
gaagcggagatggctctggtcatgaagcaggacctcatcgacaagctgaaggaggagctg
gagcagcagaggatgtctctggagactgtgccggtcctcgccgcccaggcagaaattttc
aaggcggacttcctggcagagcgagaggccagggagacgctgaaccagcgtaaggaagag
ctgcaggagcagttgaacaaggctgtggcggaaatcgatctactcaaagtcggggtcacc
tctcgagcacgcatggaggagatgcagcagaggcatatgggagagtaccgagctctcccc
acttcaggaggaatggtttcagaggagttgcctgattatcgttgcccgaaatgccagtat
caggccccggatatcgacaccctgcagatccacgtcatggactgcattcaatga

DBGET integrated database retrieval system