KEGG   Paramormyrops kingsleyae: 111840119Help
Entry
111840119         CDS       T05788                                 

Definition
(RefSeq) potassium voltage-gated channel subfamily KQT member 1-like isoform X1
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:pki00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111840119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans KCNQ_channel Ion_trans_2 Baculo_PEP_C PsbW Sec5
Motif
Other DBs
NCBI-GeneID: 111840119
NCBI-ProteinID: XP_023660383
Ensembl: ENSPKIG00000012902
LinkDB All DBs
Position
Unknown
AA seq 669 aa AA seqDB search
MSSPVSEEAGFWDTSDSPGGTRQALETLDAEYFNPETPVTYNNSASAPAYVPDTGRVAEA
PVRTRVSCPVLQPPEAVFHSPMSGTRTLLQGRVYNFLERPTGWKCFVYHFAVFLIVLTCL
ILSVLSTIDQYQTLAHSTLFWVEMALVVFFGVEYTVRLWSAGCRSKYVGVWGRLRFARKP
ISIIDLIVVIASIIVLAMGSNGQVFATSAVRGIRFLQILRMLHVDRQGGTWRLLGSVLFI
HRQELITTLYIGFLGLIFSSYFVYLAEKDEVDSSGNTEFGSYADALWWGVVTVTTIGYGD
KVPQTWIGKTIASCFSVFAISFFALPSGILGSGFALKVQQKQRQKHFNRQIPAAACLIQT
SWRCFALQNSNSATYKIFVGKRLPGNTYIQSISKSKMMLKKGRKPKTEKDNGSNSLTVPN
ITFEPVPEDCGQFSSDTHSDCQRPSEPQALRLCGRQQSWTSISSFCVPQETVRKIAPPPL
WHDSSVDDELDMDPERDSTLTPVMHTSQLRDSHRTAICIIQKMRFFLAKKRFQQARKPYD
VRDVMEQYSQGHLNLMVRIKELQRRLDHSLGKLSLFQSSSERTRNRGNNTIGSRLNRMEE
KITRMDQTLNSIAEALSRLLPGSIPAGPEGPPSGQAGGPTVLWPPTDLPSRRLSRFQKQS
ASFSLDEGP
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctccggtgtcggaggaggcaggcttttgggacaccagcgactctccgggcggg
acacggcaggcgctggagacgttagatgccgaatattttaacccagaaacaccggtcacc
tacaacaacagcgcgtccgctcccgcttatgtcccggacaccgggcgtgtggctgaagcc
ccggtaaggacccgtgtcagctgcccggtactccagccgccagaggccgtcttccactcg
cccatgtccggcactcggaccctcctccagggacgggtgtacaactttctggagagaccc
actggatggaagtgcttcgtctatcacttcgcagtgttcctcatcgtgctgacctgcctg
atcctcagcgtgctgtccaccatcgaccagtaccaaacgctggcccacagcacactcttc
tgggtggagatggcgctggtggtgttctttggggtggagtacacagtgaggctctggtca
gctggctgccgcagcaaatatgtcggcgtctggggacgacttcgctttgccaggaagccc
atctccatcatcgatttgattgtagtcatagcatccatcatcgtgctggcaatgggatcc
aacgggcaggtgtttgctacgtccgctgtcagagggattcgcttcctgcagatcctgcgc
atgctgcatgtggaccgccagggcggcacctggcgcctactgggctctgtcctgtttatc
catcgccaggagctgatcaccactctgtacatcggcttcctgggcctcatcttctcctcc
tactttgtctatttggcggagaaggacgaggtggacagcagtgggaacacggagtttggc
agctacgccgacgccctgtggtggggtgtggtgactgtcaccaccataggctatggggac
aaggtgccacagacctggattggcaagactattgcatcctgtttctcagtttttgccatc
tccttcttcgccctgccttctggaatcttgggttctggctttgctctgaaggtccagcag
aaacaaagacagaagcactttaacagacaaatcccggcagccgcctgtctcatacagact
tcgtggagatgttttgccttgcagaactctaactcagcaacctacaagatttttgtgggc
aagaggttaccaggcaacacatacatacagtccatctctaagtccaagatgatgttaaag
aaggggaggaaacccaagactgagaaggacaatgggtctaactccctcactgttcccaat
atcacgtttgagccggtgcctgaagactgcgggcagttttcctctgatacccattctgac
tgccaacgcccatctgaaccccaagccctgagattatgtggccgccagcagtcctggacg
tcaatctcctctttctgtgtcccacaagaaacagtgaggaagattgctcctccgcctctg
tggcatgacagcagtgttgacgatgaactggatatggaccccgagcgggacagtacgctc
acccccgtcatgcacacttcgcagttgagggactcccatcgaactgccatctgtataatc
cagaagatgagattctttttggccaagaagagatttcagcaagcgcgtaagccttacgac
gtgcgggacgtgatggagcagtactcacagggacatctaaacctcatggtgcgcatcaag
gagctccagaggaggcttgaccattccttggggaagctgagcttatttcagagcagctca
gagaggactagaaacagagggaataacaccattggctccaggctgaacaggatggaggaa
aagatcacacgcatggaccagacactcaacagcattgcagaagctctcagccgcctactt
cctgggtctattccagcaggacctgaagggccccccagtggccaggctgggggtcccact
gtgctctggccccccacagacttgcccagccgccgcctgtccaggttccagaagcagagc
gccagcttctccctggacgagggcccatga

DBGET integrated database retrieval system