KEGG   Paramormyrops kingsleyae: 111840201Help
Entry
111840201         CDS       T05788                                 

Gene name
pfkp
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00010  Glycolysis / Gluconeogenesis
pki00030  Pentose phosphate pathway
pki00051  Fructose and mannose metabolism
pki00052  Galactose metabolism
pki01100  Metabolic pathways
pki01200  Carbon metabolism
pki01230  Biosynthesis of amino acids
pki03018  RNA degradation
Module
pki_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111840201 (pfkp)
   00030 Pentose phosphate pathway
    111840201 (pfkp)
   00051 Fructose and mannose metabolism
    111840201 (pfkp)
   00052 Galactose metabolism
    111840201 (pfkp)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    111840201 (pfkp)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pki01009]
    111840201 (pfkp)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pki03019]
    111840201 (pfkp)
Enzymes [BR:pki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     111840201 (pfkp)
Protein phosphatases and associated proteins [BR:pki01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111840201 (pfkp)
Messenger RNA biogenesis [BR:pki03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     111840201 (pfkp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 111840201
NCBI-ProteinID: XP_023660539
Ensembl: ENSPKIG00000011873
LinkDB All DBs
Position
Unknown
AA seq 787 aa AA seqDB search
MAQPDKKFFENLSGAGKAIAVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIHEGYQGMV
DGGDNIREATWESVSSMLQVGGTVIGSARCKEFRTHEGRLKAAHNLVQHGITNLCVIGGD
GSLTGANLFREEWSGLLEELLQQGLIDADAVQKYSALHIVGMVGSIDNDFCGTDMTIGTD
SALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEMPPEDHW
EEQMCHKLSENRAGKKRLNIIIVAEGAIDSYNKPITTDHIKNLVVKCLGFDTRVTILGHV
QRGGTPSAFDRILASRMGVEAVHALLGTTANTPACVVSLCGNQAVRLPLMECVQMTQEVQ
KAMDEKKFEEAVKLRGRSFENNLNTYKLLAHRKAESELPTSSFNVAVLNVGAPAAGMNAA
VRSAVRVGISEGHKMFAVNDGFEGFAKGQIKEIKWGDVGGWTGQGGSLLGTKRTLPGKYL
DKIAEQMTLHNINALLVIGGFEAYLGLMDFLAARKDHEAFCVPMVMVPATVSNNIPGSDL
SIGADTALNAITDTCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAAGADAAYVFEE
PFDIRDLQANVEHLREKMKTSIQRGLVLRNENSNVNYTTDFIYQLYTEEGRGIFDCRKNV
LGHMQQGGAPSPFDRNFGTKISAKAMQWISKKLKEGYRQDEGRVFTNTEDSACLLGMRRR
ALVFQPVVQLKDQTDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVVRNRPR
ETDAATL
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagccagacaagaaatttttcgagaacctctcgggcgccggcaaagccatcgcc
gtgctgacgagcgggggggatgctcaaggtatgaacgcagccgttcgcgctgtcgtccgc
atgggaatctacgtgggagccaaagtgtatttcatccacgagggctatcagggcatggtg
gacgggggagataacatcagggaggccacatgggagagcgtctccagcatgctgcaagtg
ggcggtacggtaatcggcagcgcccgctgtaaggagttccgcacgcacgagggccgcctg
aaggccgcgcacaacctggtgcagcacggcatcaccaacctgtgcgtcatcggcggcgac
gggagcctcacgggcgcaaacctctttagggaggagtggagcggccttctggaggagctg
ctgcagcagggcctgatcgacgcggacgcggtgcagaagtactcggccctgcacatcgtc
ggcatggtgggctccatcgacaacgacttctgcggcactgacatgaccatcggaacggac
tcggccctgcacaggatcattgaggtggtggatgccatcatgaccacagcccagagccac
cagaggacgtttgtgctggaggtgatgggacgccattgcggctacctggccctggtgagc
gccctggcctgcggggctgactgggtcttcatccccgagatgccccctgaggaccactgg
gaggagcagatgtgccataaactttctgagaaccgcgcgggaaagaaaaggctgaatatc
attattgtagcggagggggccattgattcgtacaacaagcccattaccactgaccatatt
aagaatctcgtggtgaaatgcctggggttcgacacacgagtcaccattctgggacacgtc
cagaggggcgggacgccctcggcgttcgaccgcatcctggctagccggatgggcgtggag
gccgtccatgctctgttggggacgacggccaacaccccggcctgcgtggtgtcgctctgc
gggaaccaggccgtgcgcctgccactgatggagtgcgtgcagatgacacaagaggtgcag
aaagccatggatgagaagaagtttgaagaagccgtgaagctgcgtggcaggagcttcgaa
aataacctgaacacgtacaaactcctcgcgcatcgaaaggcggagtcagagcttccgacg
agctcctttaacgtggccgtgctgaacgtgggtgcccccgccgcgggcatgaacgctgcc
gtgcggtccgccgtcagggtgggcatctccgaggggcacaagatgttcgcggtcaacgac
ggcttcgagggcttcgccaagggacagataaaggagatcaaatggggtgatgttggaggg
tggactggccaagggggctcccttttagggacaaaacggacccttcctggcaaatacctg
gataaaatcgcggagcagatgactctgcacaacatcaacgcgctgctggtcatcggaggc
tttgaggcctacctgggactgatggactttctagccgcccgcaaggaccacgaggctttt
tgtgtccccatggtcatggtgccggccaccgtctccaacaatataccgggttctgacctc
agcattggcgcagacactgctctgaatgccattactgacacatgcgaccgcatcaagcag
tcggccagcgggaccaagcggcgcgtcttcatcatcgagaccatggggggctactgcgga
tacctggccactgtgggggggctggcggccggcgccgacgccgcctacgtcttcgaggag
cccttcgacatccgggacctgcaggctaatgtggagcatctgagggagaagatgaagacc
agtatccagagagggttggtgctgaggaacgagaactcgaacgtcaactacacgacggac
ttcatctaccagctgtacaccgaagagggccgaggcatcttcgactgcaggaagaacgtc
ctgggccacatgcagcagggaggcgcgccatctccgttcgacagaaacttcgggacaaaa
atatcagccaaggctatgcagtggatctctaagaaactcaaggagggctacaggcaagat
gaaggccgggtgttcaccaacacagaggactccgcctgcctgctggggatgcggcggaga
gccctggtcttccagcccgtggtgcagctgaaggaccagacggacttcgtacaccggatc
ccgaaggagcagtggtggctgaaactccgccccctaatgaagatcctggccaaatacaag
accagctacgacgtgtccgactcgggccagctggagcacgtggtgcggaaccggcccagg
gagacagacgctgctaccctctga

DBGET integrated database retrieval system