KEGG   Paramormyrops kingsleyae: 111842512
Entry
111842512         CDS       T05788                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04068  FoxO signaling pathway
pki04217  Necroptosis
pki04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111842512 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111842512 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111842512 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pki03000]
    111842512 (stat3)
Transcription factors [BR:pki03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    111842512 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2
Other DBs
NCBI-GeneID: 111842512
NCBI-ProteinID: XP_023664939
Ensembl: ENSPKIG00000000984
LinkDB
Position
Unknown
AA seq 785 aa
MAQWNQLQQLDPRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQHLQSKYLEKPMEIARIVARCLWEEQRLLQTAT
TASQDGQAAHPTGTVVTEKQQMLEHSLQDVRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
QGELSQDLNGNSQAAATRQKMAQLEQMLTALDQLRRQIVTEMAGLLSAMEFVQKNLTEEL
AEWKRRQQIASIGGTPNICLDRLENWFTSSAESQLQIRQQIKKLEELQQKVSYKGDPIIQ
HRPALEEKIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKESGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRTSSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNHPKNVNFFTKPPVATWDQVAEVLSWQFSSTTKRGLNIEQLTTLAEKLLGPCVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILVLWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDINGKTQIQSVEPYTKQQLNSMSFAEIIMGYKIM
DATSILVSPLVYLYPEIPKEEAFGKYCRTEAAESDPTDPGSAVPYLKTKFICVTPCPSVF
MDLPDSELLANGFPGTNSGNTSDLFPMSPRTLDSLMHNEGAEANPGPLESLTLDMDFSSD
AASPM
NT seq 2358 nt   +upstreamnt  +downstreamnt
atggcccagtggaaccagttgcagcagctggaccccagatacctggagcagctgtaccac
ctgtacagtgacagcttcccgatggagctgcggcagttccttgccccttggatcgagagc
caggactgggcctacgctgccaacaaagagtcccacgccaccctggtgttccacaacctc
ttgggggagattgatcagcagtacagccggttcctgcaggagagcaacgtcctttaccag
cacaacctgaggaggatcaagcagcatctgcagagcaagtacctagagaagcctatggag
attgcccgcattgtggcccgctgcttgtgggaagagcagcgcctgctgcagacggccacc
acggcctcccaggatggacaggctgcccaccccacaggaacagttgtgaccgagaagcag
cagatgcttgagcacagcctacaggatgtcaggaagagggtacaggatatggagcagaag
atgaagatgctagaaaacctgcaggatgactttgactttaactacaaaaccttgaaaagc
caaggagaactgtcacaggacttgaacggcaacagccaggccgcagccacccgccagaaa
atggcccagctggagcagatgctcacagccctggaccagctcagaaggcaaattgtgaca
gagatggcagggctgctgtcggcgatggaatttgtgcagaagaacctgacggaggagctg
gccgagtggaaaagaaggcaacagattgcctcgattggaggaacccccaatatctgcctg
gatcgtctggagaactggtttacatcctcggccgagtcccaactgcagatccgacagcag
atcaagaagctggaggagctgcagcagaaagtgtcctacaagggagaccctattatccag
catcggccagctctggaagagaagattgtggacctcttccgaaacctcatgaagagtgcg
tttgtggtggagcgtcagccttgtatgcccatgcatccagaccggcctttggtcatcaaa
accggtgttcagttcaccaccaaagtgaggctactggtgaaatttccggagttgaattac
cagctaaaaatcaaagtctgcattgacaaagaatcgggggatgttgctgctctgcgcggg
tcacgaaagttcaacatactgggtactaacacgaaagtgatgaacatggaggagtccaac
aatggcagtctctctgcggagttcaagcacttgactttgagggagcagagatgcgggaat
ggtggaaggaccagcagtgatgcctctttgattgtgacagaggaactccaccttataact
tttgaaactgaggtctaccaccaagggctgaagattgacttagagacgcattccctccca
gtcgtcgtgatctccaacatctgtcagatgccgaatgcctgggcctcaatcctgtggtac
aacatgctcaccaaccacccgaagaatgtgaacttcttcaccaaaccgccggtggccaca
tgggaccaggtggctgaagttctgagctggcagttctcctcgaccaccaagcgaggcctc
aacatcgagcagctcaccaccctggcagagaaactcttggggccatgtgtgaactactcg
gggtgccagataacctgggcaaagttctgcaaagaaaacatggctggcaaaggcttctcc
ttctgggtctggctggacaacatcattgacttggtgaagaagtacatcctggtattgtgg
aatgaagggtacatcatgggcttcatcagcaaggagcgggagcgggccatcctgagcacc
aagccccccggcaccttcctgctacgcttcagtgagagcagcaaggaaggtggcatcacc
ttcacctgggtggagaaggacatcaacggaaagactcagattcagtctgtggagccgtac
accaaacagcagctcaacagcatgtccttcgccgagatcatcatgggctacaagatcatg
gatgccaccagcatcctggtttccccactcgtctacctctacccagagatccctaaggaa
gaggcatttgggaagtactgcagaaccgaggccgctgagtctgacccgactgacccaggt
agtgctgtaccatacctgaaaacaaagttcatctgcgtcaccccgtgcccctccgtgttc
atggacttgccggacagcgagctcctggcgaatggattccccggtacaaactcgggaaac
actagtgacctgttccccatgtcccctcgcaccctggactcattgatgcacaatgagggg
gctgaagccaaccctggccccttggaatccctcactctagacatggacttcagctctgac
gcagcttcgcccatgtga

DBGET integrated database retrieval system