KEGG   Paramormyrops kingsleyae: 111842807
Entry
111842807         CDS       T05788                                 

Gene name
atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04141  Protein processing in endoplasmic reticulum
pki04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:pki00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111842807 (atf6b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111842807 (atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pki03000]
    111842807 (atf6b)
Transcription factors [BR:pki03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    111842807 (atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf YabA DUF4140 CENP-H
Other DBs
NCBI-GeneID: 111842807
NCBI-ProteinID: XP_023665578
Ensembl: ENSPKIG00000012527
LinkDB
Position
Unknown
AA seq 696 aa
MTTELLSDLDSRFFADNLLTSEDWDACLYQCESMEEGEDAEYTGGMKYNTMFDNDLVLTL
DPDNPTSPWKHLNDNLLTGENPVLKDDATITQPLPVDMLFQVKAEPLSPASSLGSDCSLT
STPDSQVTVKGENPPTPPYMFGDILSPPVGTLQVTVTPSAQPQSQAAHIATHTSTDPQVQ
APAGPVGPAVPSATALKANSILSSKPPIQPRPLCVAALPVPQSPSPAKTLILQGLPGMDQ
NRPVVLSQSVCLGSTPAIVKVEPVSPSIPHCAGPPATPAAKPIIPATSLPGNSANDIDMK
VLKRQQRMIKNRESACQSRKKKKEYLQSLEAQLKEAQRENERLRRENQALRERLAGKEGG
ESGGNKRAVCVMVVLLFITFSFRPVSITDRKLESGLQEEAAPLTGRHLLEIGPAEESARM
RESERTPVERIESEEEGEERWRRGEMERESADSYQLRNLSGVFSDMKDLVLPDLDRYFTA
SDCRQFNRSESLRLADELRGWAHRHQIDRKKSGRKPKIVKKARVAQKSQQRKMNFSRYLP
IQTHSSMESQLQVFPGPEVTYSDFLDAIDRREDTFYVVSFRRDHLLLPAISHNKTTRPKM
SLVMPAMSVNESMYESSQGYEMMMQVDCEVMDTRIIPIKASAVPPSLRDPPPPPPSHHHP
SNHTSFRGRHSHGSGQAAATAGRREADYFISQEGGV
NT seq 2091 nt   +upstreamnt  +downstreamnt
atgactacagaattactgtccgatttagacagccgtttcttcgccgataaccttctcact
agcgaagactgggatgcctgtctgtaccagtgtgagagcatggaggagggagaggatgcg
gagtacaccggagggatgaaatacaacaccatgtttgataacgatctcgtccttacactt
gatcctgacaaccctacgtcgccatggaaacaccttaacgataaccttctaacaggggaa
aaccctgttttaaaagatgatgcaaccattacgcagcccttacccgtggatatgttgttt
caggtgaaggccgagcccctctccccagcgtcctccttggggtctgactgctctctgacg
tccaccccggattcccaggtgacggtgaaaggggagaacccgccgactcccccctacatg
ttcggggacatcctgtcacccccagtagggacattacaggtgacggtgaccccatctgca
cagccgcagtcccaggcggcccacattgccacgcacaccagcactgacccacaagtgcag
gccccagcaggtcccgtaggtccagcggtgccctcggccacagccctcaaagccaacagc
atcctgagcagcaagccgcccatccagccccggcccttgtgtgtggctgccctgcctgtc
ccgcagagccccagtcctgccaagacgctcatcctccagggcctgcctggcatggaccag
aaccgacctgttgtgctctcgcagtcagtctgccttggctcgaccccagccatcgtcaag
gtggagcctgtatcacccagcattccccactgcgccgggccacctgccacccccgctgcc
aagcccatcattcccgccacgtctctgccagggaacagcgccaacgacatcgacatgaag
gtgctgaagaggcagcagcgcatgattaagaaccgggagtccgcatgtcagtcacgcaag
aagaagaaggagtacctgcagagcctggaggcccagctgaaggaggcgcagcgggagaac
gagcggctccgcagggagaaccaggcgctgcgggagcggctggctgggaaggagggagga
gaatcaggcggcaacaagagagccgtgtgcgtcatggtggtgctgctcttcatcaccttc
agcttcaggcccgtcagcatcacagacaggaagttagagtctgggttacaggaagaagca
gcccctctcactgggagacacctacttgaaattgggccggccgaggagagcgccaggatg
cgtgagagcgagaggacaccggtggagcggatagagagtgaggaggagggcgaggaaagg
tggaggaggggcgagatggagagagagtctgcagattcctaccagctaagaaacctaagc
ggtgtcttcagcgacatgaaggacctggttctaccagaccttgaccgttacttcaccgcc
tcagactgccggcagtttaaccgctccgagtccctccggctcgcggatgagctacggggc
tgggcccacaggcatcagatagaccggaagaagtctggaagaaagccgaagatagtgaag
aaggccagggtagctcagaaatcccagcagaggaagatgaatttctccagataccttccc
atccagacacacagctcgatggagagtcagttgcaagtgtttccaggaccagaggtcacc
tacagtgacttcctggacgccattgaccggcgtgaagacacgttctacgtggtctccttc
cggcgggaccacctactgctgccggccatcagccacaacaaaaccacgcggcccaagatg
tccctggtgatgccagccatgtccgttaatgaaagcatgtatgagtcctcccagggctac
gagatgatgatgcaggtcgactgtgaggtcatggacacccgcatcatccccatcaaggcc
tccgctgtgcccccgtccctgcgggaccccccaccacctcccccctcccatcaccacccc
agcaaccacacgtccttccgcggccgtcactcccatggctccgggcaggcagcagcaact
gccggcagaagggaagcagactatttcatcagccaggaggggggtgtttga

DBGET integrated database retrieval system